SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218547515|ref|YP_002381306.1| from Escherichia fergusonii ATCC 35469

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218547515|ref|YP_002381306.1|
Domain Number 1 Region: 25-274
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.00000000434
Family Phosphate binding protein-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218547515|ref|YP_002381306.1|
Sequence length 317
Comment periplasmic binding protein [Escherichia fergusonii ATCC 35469]
Sequence
MKRTLMSCAVASLLVSGSALAAWPEKPIQIIVPWGAGGNTDTVARLVAEGLQKELKVNVN
VVNRTGGAGVVGHDAIAKAKADGYTLGIATVEITMMHHQGMTALTYQNYTPITRLAVNLG
GVQVAANSQFENIVQMTDYIKANPGKLKASGSGLNSGWHLNLIGMLDSMGLPSSAVTWVP
SEGSSSALMELVSGGIDFTTSSPGEAKSMVDAKMVRNLATMAEKSAGLYKDLPVFQQATG
YKYHLATWNALVVPAGTPEEVSQKLTAAMQAVFAQGKLQEFATKQGFEVYPLYGKEMTTF
MADEDARYGKLITKIKG
Download sequence
Identical sequences B7LWE5 F0JPV8
WP_000831652.1.24170 WP_000831652.1.31509 WP_000831652.1.80724 WP_000831652.1.97160 gi|218547515|ref|YP_002381306.1| 585054.EFER_0076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]