SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218548373|ref|YP_002382164.1| from Escherichia fergusonii ATCC 35469

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218548373|ref|YP_002382164.1|
Domain Number 1 Region: 29-369
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.58e-105
Family Phosphate binding protein-like 0.00000000000316
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218548373|ref|YP_002382164.1|
Sequence length 370
Comment putrescine ABC transporter periplasmic-binding protein [Escherichia fergusonii ATCC 35469]
Sequence
MTALNKKWLSGMVAGALMAVSVGTLAAEQKTLHIYNWSDYIAPDTVANFEKETGIKVVYD
VFDSNEVLEGKLMAGSTGFDLVVPSASFLERQLTAGVFQPLDKSKLPEWKNLDPELLKLV
AKHDPDNKFAMPYMWATTGIGYNVDKVKAVLGENAPVDSWDLILKPENLEKLKSCGVSFL
DAPEEVFATVLNYLGKDPNSTKADDYTGPATDLLLKLRPNIRYFHSSQYINDLANGDICV
AIGWAGDVWQASNRAKEAKNGVNVSFSIPKEGAMAFFDVFAMPADAKNKDEAYQFLNYLL
RPDVVAHISDHVFYANANKEATPLVSAEVRDNPGIYPPADVRAKLFTLKVQDPKIDRVRT
RAWTKVKSGK
Download sequence
Identical sequences B7LN18
585054.EFER_0997 gi|218548373|ref|YP_002382164.1| WP_000126104.1.80724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]