SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218548382|ref|YP_002382173.1| from Escherichia fergusonii ATCC 35469

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218548382|ref|YP_002382173.1|
Domain Number 1 Region: 1-242
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.87e-73
Family Phosphate binding protein-like 0.0000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218548382|ref|YP_002382173.1|
Sequence length 243
Comment arginine ABC transporter substrate-binding protein [Escherichia fergusonii ATCC 35469]
Sequence
MKKVLIAALIAGFSLSATAAETIRFATEASYPPFESMDANNQIVGFDVDLAQALCKEIDA
TCTFSNQAFDSLIPSLKFRRVDAVMAGMDITPEREKQVLFTTPYYDNSALFVGQQGKYTS
VDQLKGKKVGVQNGTTHQKFIMDKHPEITTVPYDSYQNAKLDLQNGRIDGVFGDTAVVTE
WLKDNPKLAAVGDKVTDKDYFGTGLGIAVRQGNTELQQKFNTALEKVKKDGTYETIYNKW
FQK
Download sequence
Identical sequences A0A062Y7G4 A0A0L7AJ51 A0A1X3JV10 A0A2A9BHG8 B1ERW8 B7LN27 E9XN94 E9YS82 F0JX38 I2RB59
gi|218548382|ref|YP_002382173.1| WP_000756580.1.100531 WP_000756580.1.101962 WP_000756580.1.1141 WP_000756580.1.12944 WP_000756580.1.18428 WP_000756580.1.19545 WP_000756580.1.20442 WP_000756580.1.2153 WP_000756580.1.24170 WP_000756580.1.24902 WP_000756580.1.27585 WP_000756580.1.29893 WP_000756580.1.30222 WP_000756580.1.31509 WP_000756580.1.31878 WP_000756580.1.33896 WP_000756580.1.40140 WP_000756580.1.42880 WP_000756580.1.43918 WP_000756580.1.44133 WP_000756580.1.4515 WP_000756580.1.47647 WP_000756580.1.47837 WP_000756580.1.49141 WP_000756580.1.51283 WP_000756580.1.53845 WP_000756580.1.5512 WP_000756580.1.58244 WP_000756580.1.62015 WP_000756580.1.63113 WP_000756580.1.63330 WP_000756580.1.63444 WP_000756580.1.67456 WP_000756580.1.70264 WP_000756580.1.71995 WP_000756580.1.78188 WP_000756580.1.78706 WP_000756580.1.79137 WP_000756580.1.80724 WP_000756580.1.83384 WP_000756580.1.8517 WP_000756580.1.85336 WP_000756580.1.8582 WP_000756580.1.86294 WP_000756580.1.86731 WP_000756580.1.86934 WP_000756580.1.87733 WP_000756580.1.8873 WP_000756580.1.89745 WP_000756580.1.90315 WP_000756580.1.91494 WP_000756580.1.91894 WP_000756580.1.93768 WP_000756580.1.94907 WP_000756580.1.97160 WP_000756580.1.97247 585054.EFER_1006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]