SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218550935|ref|YP_002384726.1| from Escherichia fergusonii ATCC 35469

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218550935|ref|YP_002384726.1|
Domain Number 1 Region: 21-224
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.51e-37
Family Phosphate binding protein-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218550935|ref|YP_002384726.1|
Sequence length 225
Comment extracellular solute-binding protein [Escherichia fergusonii ATCC 35469]
Sequence
MSSHSALRFAINLGNAMLAGQSSGGELHGFTVELAKKMAAACQRQCELISYPAAKRIVDD
AEKGHWDIAFLAVDPAREGELRFTEPYLTLDCTLLVRHESNIHTVQEMDRPGTVINVGKG
SAYSLPLVRQLQHAQLQEYSTTQQALAAFLAGEGDMMANIRQVLERTARDNASVRVLPDS
YSQIKQAFCVPRNDPQNYAAVSRWLAAWKEDGTLAKLEDKYIGKH
Download sequence
Identical sequences B7LU15
gi|218550935|ref|YP_002384726.1| WP_000094745.1.80724 585054.EFER_3661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]