SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|217979736|ref|YP_002363883.1| from Methylocella silvestris BL2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217979736|ref|YP_002363883.1|
Domain Number 1 Region: 2-95
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 2.75e-25
Family 2Fe-2S ferredoxin-related 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|217979736|ref|YP_002363883.1|
Sequence length 98
Comment ferredoxin [Methylocella silvestris BL2]
Sequence
MPLLTIQPSGKTIEAAEGTSLLDALLAAGEKIVSKCGGNAKCGQCHVFVQEGRKTISKMT
RVENEMLDTIIGVGSKSRLACQAMFGTEPVTVEVLSFV
Download sequence
Identical sequences B8EJ29
395965.Msil_3636 WP_012592589.1.32329 gi|217979736|ref|YP_002363883.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]