SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|217977813|ref|YP_002361960.1| from Methylocella silvestris BL2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217977813|ref|YP_002361960.1|
Domain Number 1 Region: 214-348
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 9.04e-36
Family Aromatic dioxygenase reductase-like 0.018
Further Details:      
 
Domain Number 2 Region: 118-208
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2.87e-23
Family Ferredoxin reductase FAD-binding domain-like 0.0018
Further Details:      
 
Domain Number 3 Region: 8-98
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 3.15e-22
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|217977813|ref|YP_002361960.1|
Sequence length 351
Comment oxidoreductase FAD/NAD(P)-binding domain-containing protein [Methylocella silvestris BL2]
Sequence
MVSKPDTSKPLHMVRLQPTGTEFGVYEGETVLNAGFRQGVALIHGCKEGQCSACKAVLLD
GDAEMLKYSTFALPESERDANHVLLCRTIPFSDLEIELLMFDEELLSHSVAVSEFVGEVA
AVEALTADIRRLVLTLDRPMTFFAGQYADITLPDGATTRSYSMGNPPRDPTRLEFIIKKY
EGGRFSSQLDTLAPGAKVTVSGPYGTCFRREHRDDSPLLLIGGGSGLAPLLAILEDQIAE
APQRSIRLFYGARTQADLFWQKRFEALEAELPDFRFVPALSAAPDDGQWSGERGFIHEVV
QRGLKAEGIGDGADAYACGPPPLIDAVMPVLQMAGVEPDRIYFDKFTPATN
Download sequence
Identical sequences B8EK58
gi|217977813|ref|YP_002361960.1| 395965.Msil_1650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]