SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217979979|ref|YP_002364126.1| from Methylocella silvestris BL2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217979979|ref|YP_002364126.1|
Domain Number 1 Region: 459-560
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000471
Family Anti-sigma factor antagonist SpoIIaa 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|217979979|ref|YP_002364126.1|
Sequence length 573
Comment sulfate transporter [Methylocella silvestris BL2]
Sequence
MDRSMTTAAIAPSFAALFTPKLVTVLRERYGLADFRADVIAGLTVAIVALPLSMAIAIAS
GVTPDRGLYTAIVGGFFVSLLGGSRFQIGGPAGAFIVLVATTVAIHGVDGLIIATFLSGI
ILLSIGFLRLGAFIKFIPYPVTVGFSAGIATIIFASQIKDLLGLTLSGPEPGPLFEKLGA
LGAALPSLSLPAFCVSGATIAIILLVRRYRPHWPGMLIAVAVASLAGFALALPIDTIGSH
FGGIPRGLPAPSLPALSLDRIVTLLPVAFSFALLGSIESLLSAVVADSMSGRRHRSNCEL
VAQGVANMASALFGGICVTGTIARTATNVRSGARSPIAGMLHAAFLLLFMLVAAPLASYI
PLAALAGVLAIVAWNMAEQHAFTTLIRASRGDAVVLLATFLLTIFRDLTTGILAGFSLAS
LVFMRRMSQSLQVEAVGTFGPDDEGDAGENGAGYGALTSDRDIVAFKISGAFFFGAAAGV
SAVLDEIAEQPKAFIIDLSAVSALDSTAAAAIGDFAAKAHRRGAFVYISGASKVVRRALL
MSTDGVRRVRFKDDIRTAAAAARAAIGAPPAPV
Download sequence
Identical sequences B8EMT5
WP_012592832.1.32329 gi|217979979|ref|YP_002364126.1| 395965.Msil_3882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]