SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|198282205|ref|YP_002218526.1| from Acidithiobacillus ferrooxidans ATCC 53993

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|198282205|ref|YP_002218526.1|
Domain Number 1 Region: 110-293,426-586
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.03e-107
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000549
Further Details:      
 
Domain Number 2 Region: 290-421
Classification Level Classification E-value
Superfamily GAD domain-like 5.67e-40
Family GAD domain 0.0000165
Further Details:      
 
Domain Number 3 Region: 1-105
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.12e-31
Family Anticodon-binding domain 0.0000786
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|198282205|ref|YP_002218526.1|
Sequence length 596
Comment aspartyl-tRNA synthetase [Acidithiobacillus ferrooxidans ATCC 53993]
Sequence
MRTHYCNGIHEGLIGQTVTLCGWAQRRRDHGGVIFIDLRDREGLVQIVADPDQVDAFAAA
NECRSEFVLQVEGVLRARPAGTENPHMPSGKVELAAARIRILNRSEPVPFPLDEEDIAEN
LRLKYRYLDLRRPEMLHRLRLRHQVTRFVRGYLDNAGFIDVETPVLTRSTPEGARDYLVP
SRTQPGHFFALPQSPQLFKQLLMVAGLDRYYQITKCFRDEDLRADRQPEFTQIDIEASFV
DEEAVMGTAEPMIRGLFAEVLGVQLPDPFPRMTYRDAMHRFGVDRPDLRNPLELTELTDL
MRAVDFKVFREAAERPHGRVACLRVPGGAQLSRAQIDAYTQFTAIYGARGLAWIKVNALD
QGNEGLQSPIVKFLPEMVLSEILRRSGAAAGDILFFGADTAKIVNEALGNLRNRVAADLG
LLEGEWCPVWITDFPMFDYDDKEDRWTSTHHPFTAPQTEHLETLGQDPGNALARAYDLVL
NGNEIGGGSIRIHQEAVQEKVFAALGIGAEEARDKFGFLLDALHYGAPPHGGLAFGLDRL
VMLLCGAETIRDVIAFPKTQKAGCLLTEAPGTVADKQLQELGIRLRPGVGGGVPNP
Download sequence
Identical sequences B5EJL3 B7J3F7
gi|218666964|ref|YP_002424570.1| WP_012535765.1.13253 WP_012535765.1.28209 WP_012535765.1.49158 WP_012535765.1.50737 WP_012535765.1.90948 gi|198282205|ref|YP_002218526.1| 243159.AFE_0056 380394.Lferr_0057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]