SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|198282210|ref|YP_002218531.1| from Acidithiobacillus ferrooxidans ATCC 53993

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|198282210|ref|YP_002218531.1|
Domain Number 1 Region: 65-133
Classification Level Classification E-value
Superfamily RuvA domain 2-like 2.54e-20
Family DNA helicase RuvA subunit, middle domain 0.0022
Further Details:      
 
Domain Number 2 Region: 1-63
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000628
Family DNA helicase RuvA subunit, N-terminal domain 0.00056
Further Details:      
 
Domain Number 3 Region: 147-192
Classification Level Classification E-value
Superfamily DNA helicase RuvA subunit, C-terminal domain 0.0000000301
Family DNA helicase RuvA subunit, C-terminal domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|198282210|ref|YP_002218531.1|
Sequence length 193
Comment holliday junction DNA helicase RuvA [Acidithiobacillus ferrooxidans ATCC 53993]
Sequence
MITSLTGTILQRRPPWLWLDVQGVGYELEMPLSGFYQMPAEGAALTVHTHLTIREDAHLL
YGFMTVAERDMFRLLIRVNGIGGKVALACLSGLPAERLSQAVAEGNTAQLTAIPGIGPKT
AERLVVELRDKMGGIAPGPMGRGGAGDPRQEAIAALLTLGYKPAQASQAIAGLADGLGLE
DLIRQSLQNLSRH
Download sequence
Identical sequences B5EJL8 B7J3G2 F8XV59
gi|218665092|ref|YP_002424575.1| gi|198282210|ref|YP_002218531.1| WP_009567692.1.13253 WP_009567692.1.28209 WP_009567692.1.49158 WP_009567692.1.50737 WP_009567692.1.90948 243159.AFE_0061 380394.Lferr_0062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]