SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|198282632|ref|YP_002218953.1| from Acidithiobacillus ferrooxidans ATCC 53993

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|198282632|ref|YP_002218953.1|
Domain Number 1 Region: 2-123
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.17e-53
Family Cold shock DNA-binding domain-like 0.00000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|198282632|ref|YP_002218953.1|
Sequence length 123
Comment 30S ribosomal protein S12 [Acidithiobacillus ferrooxidans ATCC 53993]
Sequence
MPTLNQLVRKPRKRPVAKSKVPALDANPQKRGVCTRVYTTTPKKPNSALRKVARVRLTNG
FEVSSYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDTAGVKNRKQSRSKYGAK
RPK
Download sequence
Identical sequences A0A179B773 A0A1C2IH63 A0A1E7XX81 A0A2I1DQ66 B5ELX4 B7J462 E6QH04 G0JRT8
gi|344200792|ref|YP_004785118.1| gi|198282632|ref|YP_002218953.1| gi|218665629|ref|YP_002424825.1| 243159.AFE_0322 380394.Lferr_0492 WP_010641426.1.13253 WP_010641426.1.20804 WP_010641426.1.2241 WP_010641426.1.28209 WP_010641426.1.37242 WP_010641426.1.38761 WP_010641426.1.43352 WP_010641426.1.45876 WP_010641426.1.49158 WP_010641426.1.50737 WP_010641426.1.57798 WP_010641426.1.61056 WP_010641426.1.77546 WP_010641426.1.78061 WP_010641426.1.85707 WP_010641426.1.88265 WP_010641426.1.90948 WP_010641426.1.97708 WP_010641426.1.99721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]