SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|198282640|ref|YP_002218961.1| from Acidithiobacillus ferrooxidans ATCC 53993

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|198282640|ref|YP_002218961.1|
Domain Number 1 Region: 126-272
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.14e-61
Family C-terminal domain of ribosomal protein L2 0.000000645
Further Details:      
 
Domain Number 2 Region: 3-125
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.47e-43
Family Cold shock DNA-binding domain-like 0.0000279
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|198282640|ref|YP_002218961.1|
Sequence length 274
Comment 50S ribosomal protein L2 [Acidithiobacillus ferrooxidans ATCC 53993]
Sequence
MALIKTKPTSAGRRFVVKTIDTRLHKGNPHSALVEVQSHSGGRNNLGRVTRRHQGGGHKS
HYRLVDFKRNKLDIPGKVERLEYDPNRSAHIALICYVDGERRYILAAKGMSVGDPVLSAE
QTPIKPGNCMPLRGIPVGSVVHNVEMRPGKGGQIARSAGASVQLMAREGDYAQLRLRSGE
VRRIHVSCRATIGEVGNEEHGSRQLGKAGATRWRGVRPTVRGVAMNPVDHPHGGGEGRTS
GGRHPVSPWGQPTKGYRTRRNKRTSNMIVRRRSR
Download sequence
Identical sequences B5ELY2 B7J470 E6QH17 F8XR13
WP_009565434.1.13253 WP_009565434.1.28209 WP_009565434.1.49158 WP_009565434.1.50737 WP_009565434.1.90948 gi|198282640|ref|YP_002218961.1| 243159.AFE_0330 380394.Lferr_0500 gi|218667921|ref|YP_002424833.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]