SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|198282646|ref|YP_002218967.1| from Acidithiobacillus ferrooxidans ATCC 53993

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|198282646|ref|YP_002218967.1|
Domain Number 1 Region: 8-83
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.11e-33
Family Cold shock DNA-binding domain-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|198282646|ref|YP_002218967.1|
Sequence length 91
Comment 30S ribosomal protein S17 [Acidithiobacillus ferrooxidans ATCC 53993]
Sequence
MTEAKNPRSLVGTVVSNLMDKSIVVNVERRIQHPLYKKYIRRSKKFHAHDAENICHIGDI
VKIEECRPLSKTKSWRLVSVLAEGVIEGDNA
Download sequence
Identical sequences B5ELY8 B7J476 F8XWU2
243159.AFE_0336 380394.Lferr_0506 gi|218666491|ref|YP_002424839.1| WP_009569558.1.13253 WP_009569558.1.28209 WP_009569558.1.49158 WP_009569558.1.50737 WP_009569558.1.90948 gi|198282646|ref|YP_002218967.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]