SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|198282659|ref|YP_002218980.1| from Acidithiobacillus ferrooxidans ATCC 53993

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|198282659|ref|YP_002218980.1|
Domain Number 1 Region: 1-70
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.57e-27
Family Cold shock DNA-binding domain-like 0.0000915
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|198282659|ref|YP_002218980.1|
Sequence length 72
Comment translation initiation factor IF-1 [Acidithiobacillus ferrooxidans ATCC 53993]
Sequence
MSKEDTLEMQGEVVENLPSATFKVRLENGYVVNAHISGKMRMHYIRILPGDKVTVEMTPY
DLTKGRIIYRAK
Download sequence
Identical sequences B5EM01 B7J499 E6QH24 F8XVP6
243159.AFE_0349 380394.Lferr_0519 gi|218666290|ref|YP_002424852.1| gi|198282659|ref|YP_002218980.1| WP_009568282.1.13253 WP_009568282.1.28209 WP_009568282.1.49158 WP_009568282.1.50737 WP_009568282.1.90948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]