SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|198282694|ref|YP_002219015.1| from Acidithiobacillus ferrooxidans ATCC 53993

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|198282694|ref|YP_002219015.1|
Domain Number 1 Region: 1-129
Classification Level Classification E-value
Superfamily Transcription factor NusA, N-terminal domain 2.22e-38
Family Transcription factor NusA, N-terminal domain 0.00014
Further Details:      
 
Domain Number 2 Region: 202-279
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 2.62e-29
Family Prokaryotic type KH domain (KH-domain type II) 0.0001
Further Details:      
 
Domain Number 3 Region: 136-201
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.8e-18
Family Cold shock DNA-binding domain-like 0.0041
Further Details:      
 
Domain Number 4 Region: 351-416
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 8.01e-16
Family NusA extra C-terminal domains 0.0032
Further Details:      
 
Domain Number 5 Region: 281-344
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 0.00000000000000105
Family Prokaryotic type KH domain (KH-domain type II) 0.00049
Further Details:      
 
Domain Number 6 Region: 431-492
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.000000000000377
Family NusA extra C-terminal domains 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|198282694|ref|YP_002219015.1|
Sequence length 493
Comment NusA antitermination factor [Acidithiobacillus ferrooxidans ATCC 53993]
Sequence
MSRELLYLADAVAHEKDVDREVIFLALEASLVSASKKKYGQDWHIAVDVDRKTGDYVTRR
LWEVVADDVADYDVDQQIRLSDARKTRPEAEPGDYLEEVLPPVEFGRIAAQTAKQVIVQK
VRDAERDRIVSDFAIRKGDIVSGLVKRMEKGNAIVDMGRAEAILPKEEMMPREAIRPGDR
VRAHLQDVRRVQRGPQLFLSRTSPELLIKLFAQEVPEIGNGMIEIMGAARDPGLRAKLAV
RSNDPRVDPVGACVGLRGNRVQTVINELKGERIDIVIWAADPASYVINALSPAEVSSIVV
DENTHSMDVVVGPEHLSQAIGRGGQNVRLATQLTGWTINILTEEEAQAKREEEESTFLNH
FIQDLGVDEDLAALLVSEGFTSIEEVAYVPVAEMMEIDGLDENLVGELRRRARDVLLNKA
IAQEEQVALSEPAEDLLSLKGMDKGLAHLLASKGVVTSEDLAELAASELCEMVGVDEERA
KALILEARAPWFA
Download sequence
Identical sequences B5EMC9 B7J4D3 F8XU60
WP_009567337.1.13253 WP_009567337.1.28209 WP_009567337.1.49158 WP_009567337.1.50737 WP_009567337.1.90948 gi|218667138|ref|YP_002424886.1| gi|198282694|ref|YP_002219015.1| 243159.AFE_0390 380394.Lferr_0554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]