SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|198282699|ref|YP_002219020.1| from Acidithiobacillus ferrooxidans ATCC 53993

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|198282699|ref|YP_002219020.1|
Domain Number 1 Region: 2-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-53
Family Ribonuclease PH domain 1-like 0.0000143
Further Details:      
 
Domain Number 2 Region: 289-486
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.11e-51
Family Ribonuclease PH domain 1-like 0.0000116
Further Details:      
 
Domain Number 3 Region: 144-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.03e-30
Family Ribonuclease PH domain 2-like 0.0011
Further Details:      
 
Domain Number 4 Region: 448-544
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.54e-28
Family Ribonuclease PH domain 2-like 0.0001
Further Details:      
 
Domain Number 5 Region: 552-637
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.69e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0034
Further Details:      
 
Domain Number 6 Region: 611-688
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.36e-20
Family Cold shock DNA-binding domain-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|198282699|ref|YP_002219020.1|
Sequence length 692
Comment polyribonucleotide nucleotidyltransferase [Acidithiobacillus ferrooxidans ATCC 53993]
Sequence
MTMIRKEVDFGGRRLQLETGRMARQADGAVLVSSGDTVVLVTAVGRREMKPGQDFFPLTV
NYQEKAYAAGKIPGGFFKREGRPTEKETLTSRLIDRPIRPLFPKGFMNEVQVIATVVSVD
RDNDPDILALVGASAALAVSGIPFNGPIGAARVAYIDGKYVLNPSYAQLTTSQLDLVVAG
TRQAVLMVESEAQQLSEEIMLEAVMFGHAQFQPVIETIEALAREAGKPRWEWVAPVADEA
LGVQVREKATPLLQEAYALTEKQARSKRLEDVQQAMAVEFGSDDAGRGDMVRGLLKKIET
GIVRGRILDGAPRIDGRDSKTVRPITIEAGVLPRTHGSALFTRGETQALVVATLGTKGDE
QIIDALQGESRDRFMLHYNFPPFSTGETGMVGSPKRREIGHGRLAKRAIAAVLPTDSEFP
YSLRVVSEVLESNGSSSMATVCGASLALMDAGVPLKAPVAGVAMGLIKEGARFAVLTDIL
GDEDHLGDMDFKVAGTEQGVTALQMDIKIDGITREIMAQALQQALAGRLHILGLMNGVLS
RGRGELSDYAPRIITIQINPDRIRDVIGPGGKVIRALTEETGATIDIQDNGTVTIASVDG
EAGAAAKRRIELLTADVQVDTIYDGKVAKIMDFGAFVTILPGRDGLLHISQISNERVSDV
HDHLKEGQAVRVKVLEVDRQGKIKLSMKDIPQ
Download sequence
Identical sequences B5EMD4 F8XU65
WP_009567342.1.13253 WP_009567342.1.28209 WP_009567342.1.49158 WP_009567342.1.50737 WP_009567342.1.90948 gi|198282699|ref|YP_002219020.1| 380394.Lferr_0559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]