SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|198282779|ref|YP_002219100.1| from Acidithiobacillus ferrooxidans ATCC 53993

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|198282779|ref|YP_002219100.1|
Domain Number 1 Region: 152-492
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.32e-114
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000164
Further Details:      
 
Domain Number 2 Region: 4-145
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.45e-44
Family Anticodon-binding domain 0.0000287
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|198282779|ref|YP_002219100.1|
Sequence length 496
Comment lysyl-tRNA synthetase [Acidithiobacillus ferrooxidans ATCC 53993]
Sequence
MVDQELNDQMQVRRDKLGQWRSEGHAYPNGFRRDALAGDLQERYGDMDATALEQEPIEAR
LGGRLMSRRVMGKASFADIQDQSGRIQLFVSRDNLGEEVYARFKGLDLGDIIGVDGILFR
TKTGELSLKVHSLQLLSKALRPLPEKWHGLADPETRFRQRYVDLIVTEATRRTFQIRAET
VAALRDGLRQRGFYEAETPMMQPVPGGATARPFVTHHHALDMTLYLRIAPELYLKRLVVG
GIEQVFEINRNFRNEGISTRHNPEFTMLEWYEAYADHVRAMDLTETLIRAAAQAALGTTA
ISYQGLEIDLGKPFHRLTVTESVRAHNPDLADADLRDPAVLAAKLAQLHLPCQPAWGWGK
RLIEIFEKTVEGHLQQPTFITEYPLEVSPLARRNDLDPEVTDRFELMIAGRELANGFSEL
NDPEDQSARFRAQVEAKDAGDEEAMFFDADYIRALEYGMPPTAGVGLGIDRLVMLLADQP
SIREVILFPHLRPEQS
Download sequence
Identical sequences B5EMW3 B7J4M3 F8XW94
243159.AFE_0480 380394.Lferr_0640 gi|218665818|ref|YP_002424976.1| WP_009568984.1.13253 WP_009568984.1.28209 WP_009568984.1.49158 WP_009568984.1.50737 WP_009568984.1.90948 gi|198282779|ref|YP_002219100.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]