SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|198282859|ref|YP_002219180.1| from Acidithiobacillus ferrooxidans ATCC 53993

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|198282859|ref|YP_002219180.1|
Domain Number 1 Region: 209-444
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.12e-55
Family Tandem AAA-ATPase domain 0.00000433
Further Details:      
 
Domain Number 2 Region: 443-644
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.72e-41
Family Tandem AAA-ATPase domain 0.0000215
Further Details:      
 
Domain Number 3 Region: 9-177
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.94e-31
Family RecG "wedge" domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|198282859|ref|YP_002219180.1|
Sequence length 684
Comment ATP-dependent DNA helicase RecG [Acidithiobacillus ferrooxidans ATCC 53993]
Sequence
MAGAKAGLYLQSSVSALRGVGPALVPRLQHMDLWRVQDVLFHLPSRYQDRRHIASMATLQ
AGQECAILGEIVRVDHQRGGREQWLVTVSDGSGRLQIRLFHMTVALRAQWQVGRRLWCFG
ELRGGFHGLEMIHPEWQMADVPQFQAPRHLTPFYPSSEGITQAQWRRWMAQALTLLDQLP
DYLENRLPPQWPGLREGLRLLHESADEIPSPQHPAWQRLALEELLANHLAVRRMRQSGMM
QNAPCLRSKGQLWHRFLAHLPFSPTMAQERVIAEINADLVRHRPMRRLLQGDVGSGKTLV
AAAATLTALEAGYQVAMMAPTEILAEQLHARFQQWLEPLGLEVGYLVGSRSPRARRETAE
TLAGGSLRLVIGTQSLFQEGVVFACLGLVIIDEQHRFGVEQRRQLLEKGAMPHLLVMTAT
PIPRTLAMTVHADLEVSVIDALPPGRTPVETLVMPDSRRPELIGRMQHMLEAGRQIYWVC
PLIEESEILELQAAEASVADLQAALPGVAVGLIHGRMRSTEKAEVMAAFQSGAVRILVAT
TVIEVGVDVPGASLMIIEHAERLGLAQLHQLRGRVGRGAQRSSCILLYHPPLSGKARERL
RVMRETHDGFAIARKDLELRGPGEYLGTRQAGILQMRVANILRDEALLVMVPALAERLLQ
EDPEAVQAIVQRWLGSRVDYGQVG
Download sequence
Identical sequences B5END9 B7J587
WP_012536210.1.13253 WP_012536210.1.28209 WP_012536210.1.49158 WP_012536210.1.50737 WP_012536210.1.90948 243159.AFE_0568 380394.Lferr_0722 gi|198282859|ref|YP_002219180.1| gi|218667943|ref|YP_002425060.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]