SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|198282878|ref|YP_002219199.1| from Acidithiobacillus ferrooxidans ATCC 53993

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|198282878|ref|YP_002219199.1|
Domain Number 1 Region: 1-65
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.41e-25
Family Cold shock DNA-binding domain-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|198282878|ref|YP_002219199.1|
Sequence length 67
Comment cold-shock DNA-binding domain-containing protein [Acidithiobacillus ferrooxidans ATCC 53993]
Sequence
MAVGTVKWFNDSKGFGFITPEDGKEDVFVHHSAIEGTGFKTLAEGERVNFEVTRGPKGLQ
AEKVRRA
Download sequence
Identical sequences A0A060URM6 A0A179BJ69 A0A1C2I0S0 A0A2I1DPJ6 B5ENF8 B7J5A6 F8XQM2 G0JNB6
gi|344199146|ref|YP_004783472.1| gi|218666777|ref|YP_002425079.1| 243159.AFE_0590 380394.Lferr_0742 gi|198282878|ref|YP_002219199.1| WP_009564993.1.13253 WP_009564993.1.20804 WP_009564993.1.2241 WP_009564993.1.28209 WP_009564993.1.37242 WP_009564993.1.43352 WP_009564993.1.45876 WP_009564993.1.49158 WP_009564993.1.50737 WP_009564993.1.5719 WP_009564993.1.57798 WP_009564993.1.61056 WP_009564993.1.7011 WP_009564993.1.77546 WP_009564993.1.78061 WP_009564993.1.85707 WP_009564993.1.88265 WP_009564993.1.89598 WP_009564993.1.90948 WP_009564993.1.97708 WP_009564993.1.99721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]