SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|198282943|ref|YP_002219264.1| from Acidithiobacillus ferrooxidans ATCC 53993

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|198282943|ref|YP_002219264.1|
Domain Number 1 Region: 90-371
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.69e-69
Family RecA protein-like (ATPase-domain) 0.0000000194
Further Details:      
 
Domain Number 2 Region: 49-125
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.78e-28
Family Cold shock DNA-binding domain-like 0.0000266
Further Details:      
 
Domain Number 3 Region: 1-46
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.000000000239
Family Rho termination factor, N-terminal domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|198282943|ref|YP_002219264.1|
Sequence length 418
Comment transcription termination factor Rho [Acidithiobacillus ferrooxidans ATCC 53993]
Sequence
MNLTDLKRKTAADLAVICQDMGLEGTARQKKQEIIFNILKAHARNGDAIYGEGVLEILQD
GFGFLRAASGSYMAGPDDIYVSPSQVRRFHLQTGDTVSGQIRPPKEGERYFALLKVESIN
FEAPEATRNKVNFDDLTPLFPDERLRLEYDAVPYGEMAPRIIDLVSPIGKGQRGLIVAPP
KTGKTVLLQQIAHAITANHPECYLIVLLIDERPEEVTEMQRSVKGEVVSSTFDEPATRHT
QVAEIVLEKAKRLVEHKHDVVILLDSITRLARAFNTVVPSSGKVLTGGVDANALQKPKRF
FGAARNIEEGGSLTIIATALVETGSKMDEVIFEEFKGTGNMEVHLDRRLAEKRTYPAINL
NKSGTRREELLVPAEMLSKMWVLRKLLAPMDPVESMEFLLDKVRSTKNNAEFFDSMNR
Download sequence
Identical sequences B5ENM3 B7J5V4
243159.AFE_0658 380394.Lferr_0807 gi|218665961|ref|YP_002425146.1| gi|198282943|ref|YP_002219264.1| WP_012536268.1.13253 WP_012536268.1.28209 WP_012536268.1.49158 WP_012536268.1.50737 WP_012536268.1.90948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]