SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|198283109|ref|YP_002219430.1| from Acidithiobacillus ferrooxidans ATCC 53993

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|198283109|ref|YP_002219430.1|
Domain Number 1 Region: 3-64
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.62e-17
Family eIF5a N-terminal domain-like 0.0032
Further Details:      
 
Domain Number 2 Region: 130-186
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.48e-17
Family Cold shock DNA-binding domain-like 0.003
Further Details:      
 
Domain Number 3 Region: 66-127
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.71e-17
Family Cold shock DNA-binding domain-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|198283109|ref|YP_002219430.1|
Sequence length 186
Comment translation elongation factor P [Acidithiobacillus ferrooxidans ATCC 53993]
Sequence
MKISAFDIRPGNILEYEKGLWRVLKTDFVKPGKGGAFVQVEMKNIETGTKSNTRFRSGEA
MEKAVVEPRTMQYLYADATGYVFMDNENFEQLILSEDLLEGQTGYLLPNTEIQVNLHNER
PIGVELPPVVILEVREAEPSIKGQTATGSYKSAQMETGITVMVPQFVNAGEKIRVNTVDG
SYIDRA
Download sequence
Identical sequences B5EPM9 B7J6R6 E6Q9X9
gi|198283109|ref|YP_002219430.1| 243159.AFE_0851 380394.Lferr_0977 WP_012536394.1.13253 WP_012536394.1.28209 WP_012536394.1.49158 WP_012536394.1.50737 WP_012536394.1.90948 gi|218665422|ref|YP_002425338.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]