SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|198283153|ref|YP_002219474.1| from Acidithiobacillus ferrooxidans ATCC 53993

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|198283153|ref|YP_002219474.1|
Domain Number 1 Region: 264-366
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.34e-26
Family Cold shock DNA-binding domain-like 0.0017
Further Details:      
 
Domain Number 2 Region: 199-284
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.15e-26
Family Cold shock DNA-binding domain-like 0.001
Further Details:      
 
Domain Number 3 Region: 351-450
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.42e-24
Family Cold shock DNA-binding domain-like 0.0031
Further Details:      
 
Domain Number 4 Region: 13-120
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.34e-18
Family Cold shock DNA-binding domain-like 0.0092
Further Details:      
 
Domain Number 5 Region: 443-528
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000929
Family Cold shock DNA-binding domain-like 0.01
Further Details:      
 
Domain Number 6 Region: 114-190
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000211
Family Cold shock DNA-binding domain-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|198283153|ref|YP_002219474.1|
Sequence length 568
Comment 30S ribosomal protein S1 [Acidithiobacillus ferrooxidans ATCC 53993]
Sequence
MTTPNAEMLVEPSFAEMFEESQSTQGLKPGELLTGIVTRVDNDFVIVDVGLKSEGPIPAE
QFRNAEGEIEVKVGDSVEVCLELVEDGMGETRLSREKARRAKTWVDLEKSFNDNAVVHGF
LTGKVKGGFTVSIDGVRAFLPGSLVDVRPVRDVAYLEGKDLEMKIIKLDRKRNNVVVSRR
AVVEQEQSVERGALLESIQEGAVLEGVVKNLTDYGAFIDLGGIDGLLHITDMGWRRVKHP
SEVVTVGGEVRVLVLKFDRERGRISLGMKQLGEDPWRDIARRYPEATRIFGKVTNVTDYG
AFVEIEEGVEGLVHVSEIDWTNKNINPAKALHVGQEVEVMILDIDEERRRISLGIKQCLP
NPWDDFAQNFQKGDRVSGQIKSITDFGVFVGLDGGIDGLIHLSDLAWDRTGEEAVRDFKK
GDTLDAVVLSIDPERERISLGVKQMETDPFIQFVVANEKGALVEGEVISVDSRGAEIRLG
EGVEGFLPHRELARGVTLSAGDKIEVSIAMVDRKNRTLTLSTKAREAAVSQEDQTAAVQQ
YARSAATGTTSLGDLIKEQLKRKQEEES
Download sequence
Identical sequences B5EQ22 B7J783
243159.AFE_0903 380394.Lferr_1025 WP_012536425.1.13253 WP_012536425.1.28209 WP_012536425.1.49158 WP_012536425.1.50737 WP_012536425.1.90948 gi|218667071|ref|YP_002425381.1| gi|198283153|ref|YP_002219474.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]