SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|198283218|ref|YP_002219539.1| from Acidithiobacillus ferrooxidans ATCC 53993

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|198283218|ref|YP_002219539.1|
Domain Number 1 Region: 3-140
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 7.32e-45
Family Molybdopterin synthase subunit MoaE 0.0000471
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|198283218|ref|YP_002219539.1|
Sequence length 164
Comment molybdopterin biosynthesis protein MoaE [Acidithiobacillus ferrooxidans ATCC 53993]
Sequence
MLVKVQREDFDPMAEMAAFPADAIAGAGSSVTFIGTVRDYSEATDILAMEIEHYPGMTER
ELERISAEAAQRYDILDSLIMHRYGRLAPQDNIVMVAVWSRHRAAAFDACRFLIDVLKTS
APFWKKEITPEGVRWVTDCPGCRAGSREGHTHAPHVSHSHTQVK
Download sequence
Identical sequences B5EQ87 B7J7F2
gi|198283218|ref|YP_002219539.1| 243159.AFE_0976 380394.Lferr_1090 WP_012536477.1.13253 WP_012536477.1.28209 WP_012536477.1.49158 WP_012536477.1.50737 WP_012536477.1.90948 gi|218667192|ref|YP_002425450.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]