SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|198283251|ref|YP_002219572.1| from Acidithiobacillus ferrooxidans ATCC 53993

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|198283251|ref|YP_002219572.1|
Domain Number 1 Region: 91-203
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 4.97e-19
Family RecO C-terminal domain-like 0.022
Further Details:      
 
Domain Number 2 Region: 7-79
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000497
Family RecO N-terminal domain-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|198283251|ref|YP_002219572.1|
Sequence length 255
Comment DNA repair protein RecO [Acidithiobacillus ferrooxidans ATCC 53993]
Sequence
MTTEPGDRAWVLHHYPYGDTSLIVELFTRTQGRLGVLAKGARRARSALARIEAGRPLWVR
WLGRGELPVLAQAEELGPFLPLNPLQNLSLFYVNELLLRLTQRRDPFPDLFQVYEETIDA
LCSEPGEGWYLRRFERRLLENLGWAPDLAHCAECGRSPDAASSEHWLYQAAHGVFCRAHA
PDAAVAIEAAALVWLRGAMQTRSMPVWNSSLRRCLEQELLVHLGGRPLESRRLLTAYLRR
TQPAMTIQKREEHSE
Download sequence
Identical sequences B5EQL5 B7J9K3 E6QAN7
gi|218665687|ref|YP_002425834.1| 243159.AFE_1402 380394.Lferr_1123 gi|198283251|ref|YP_002219572.1| WP_012536499.1.13253 WP_012536499.1.28209 WP_012536499.1.49158 WP_012536499.1.50737 WP_012536499.1.90948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]