SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|198283301|ref|YP_002219622.1| from Acidithiobacillus ferrooxidans ATCC 53993

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|198283301|ref|YP_002219622.1|
Domain Number 1 Region: 7-263
Classification Level Classification E-value
Superfamily PHP domain-like 6.93e-26
Family PHP domain 0.011
Further Details:      
 
Weak hits

Sequence:  gi|198283301|ref|YP_002219622.1|
Domain Number - Region: 969-1061
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000857
Family Anticodon-binding domain 0.051
Further Details:      
 
Domain Number - Region: 828-870
Classification Level Classification E-value
Superfamily AF1531-like 0.0353
Family AF1531-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|198283301|ref|YP_002219622.1|
Sequence length 1167
Comment DNA polymerase III subunit alpha [Acidithiobacillus ferrooxidans ATCC 53993]
Sequence
MMRTPQFVHLHVHSEYSLEDGIIPVKALARRCAERGMPAVAITDHGNLFALVKFYNAARG
QGVKPLIGSEVWVHDVAEPERPVSLVLLCMDKTGYRNLSRLLSRAYLEGSRHGRPQIDVA
WLEGSSDGLIALSAAGQGEIGRALQRHPQQAESRARYYARLFPERFYLEVQRNGEAEQEA
LVQATVALAEKLDLPLVATNNAHFLDAADFAAFDARQCISAGFTLDDPRRPRRFTPEHRL
PDPEEMRERFADLPEACDNTVEIARRCNMELVLGHYALPDYPIPANQSVDEYLHDAAQKG
LQERLQELRITGDATLPYHERLLREVGVIQQMGFPGYFLIVADFIQWAKNNGVPVGPGRG
SGAGSLVAYALRITDLDPIGNGLLFERFLNPERVSMPDFDVDFCMDQRDRVIQYVADKYG
RDRVGQIITFGTMKARAVVRDVGRVLGLPYGFVDQLAKLVPGDLGMTLAKALEESEELRR
RQAEEDDVRDLLDIALRLEGLPRHASTHAGGVVISPEPLADRLPLFNDGSEGGGNVTQLD
KDDVEKMGLVKFDFLGLRTLTIIDMAVKLINADAAAAGRAPVDIQQLPLDDAATFALLKS
TETAAVFQLESSGMRDLVRRLQPDTFEDIVALVALFRPGPLQSGMVDDFIARKHGKAQVT
YLHPDLAPILRETYGVIVYQEQVMQSAQALAGYSLGGADLLRRAMGKKKPEEMAKQRSIF
LEGAHKNGLAADQAGAIFDLMEKFAEYGFNKSHSAAYALVSYQTAYLKAHYPQFFMSAVL
TADMDHTDKVVAMIAECARMGLRIAPPSVQHSVLEFRPEGDDHIRFGLGAIKGLGRAAIQ
AILDARRGGAFLNLFDLLCRVDTQKINRRALEALIRAGAMDDWGVSRASLIASVDGCMEA
AAQFQSSQASLQESLFSGQEALRVAPPLVSAEAWSLTETLRQERETLGFYLSGHPMDSLR
DDLTALGTIPLGDVAVGSTVLVAGLVVARRSTRTKRGDRIYFLTLDDGQGRLEVVVFGEV
WARAGKIREGEEPVLVLGEVGEDSYSGGLRLSALRLLDTAQAREELAAQLTLDLGLAEDM
APRDLLAVLRKYPGQTALRLRLRVADDVVAQLRVTENLSFAASPAAIAALTALAPAAHWH
WSYRPVTLLVNNVVPLERARHATRRPA
Download sequence
Identical sequences B5EQR5
380394.Lferr_1177 gi|198283301|ref|YP_002219622.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]