SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|198283303|ref|YP_002219624.1| from Acidithiobacillus ferrooxidans ATCC 53993

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|198283303|ref|YP_002219624.1|
Domain Number 1 Region: 25-228
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 6.17e-56
Family PP-loop ATPase 0.0000896
Further Details:      
 
Domain Number 2 Region: 343-449
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0000000000000139
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.014
Further Details:      
 
Domain Number 3 Region: 255-315
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.000000102
Family MesJ substrate recognition domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|198283303|ref|YP_002219624.1|
Sequence length 464
Comment tRNA(Ile)-lysidine synthetase [Acidithiobacillus ferrooxidans ATCC 53993]
Sequence
MESSALPELERRLRTRLQGDLRPPRGRSLYVAYSGGGDSTALLVALLSLGYEIHALHVDH
GWHPDSAQWARFCQEQAKALGVPFTLLHLAADTPGEGPEDQARRARYALMAAQLRQGDWL
FTAQHREDQAETVLLQLLRGTGVAGLAGMPRQRPLGAGLLVRPLLDVPRQVLRDYLEQRQ
LPFLNDPANADMRYDRVRIRRILLPQLQELGWPHATISIARAADNLADMGEIATDWFDLC
WQQYRADHPGLSVEVLPLEYLHTLSVAAQRFFLRGWLQSLRISVPGRERLEALRDAVMRG
RGGARIQWEGGQAWLQGGLLRAWPQPRVTAEKEWEAGPWCAAPGKPLPIPGWQCAIRATP
PADLHHALAERFAGTRLYWRRRRQGERTLSGQGQHRSLKKLLLEAGVPPDLRADVPLLWD
ETGHLLVILGYYTAPWASAPRGEPALCLWNTGTQSIADSGVGSI
Download sequence
Identical sequences B5EQR7 B7JA40
WP_012536537.1.13253 WP_012536537.1.28209 WP_012536537.1.49158 WP_012536537.1.50737 WP_012536537.1.90948 gi|198283303|ref|YP_002219624.1| 243159.AFE_1464 380394.Lferr_1179 gi|218665676|ref|YP_002425891.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]