SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|198283404|ref|YP_002219725.1| from Acidithiobacillus ferrooxidans ATCC 53993

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|198283404|ref|YP_002219725.1|
Domain Number 1 Region: 3-145
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.83e-56
Family Single strand DNA-binding domain, SSB 0.0000099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|198283404|ref|YP_002219725.1|
Sequence length 164
Comment ssDNA-binding protein [Acidithiobacillus ferrooxidans ATCC 53993]
Sequence
MAGVNKVILLGHLGRDPEMRYMPDGTAVANMTIATSESYKDRDGNRQERTEWHRVALFAR
TAEVAGEYLRKGSRAYIEGRIRTRKWTDKDGQERYSTEIVGDRLQLIGGRRDGADGGNPA
PQHGGGGGGDMGAAPMEEFDDDIPFITKAETICQPRWRLPRVRF
Download sequence
Identical sequences B5ERB6
gi|198283404|ref|YP_002219725.1| WP_012536610.1.90948 380394.Lferr_1280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]