SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|198283673|ref|YP_002219994.1| from Acidithiobacillus ferrooxidans ATCC 53993

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|198283673|ref|YP_002219994.1|
Domain Number 1 Region: 196-506,542-642
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.71e-138
Family RNB domain-like 0.00001
Further Details:      
 
Domain Number 2 Region: 642-724
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.88e-21
Family Cold shock DNA-binding domain-like 0.0041
Further Details:      
 
Domain Number 3 Region: 76-156
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.71e-19
Family Cold shock DNA-binding domain-like 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|198283673|ref|YP_002219994.1|
Sequence length 746
Comment ribonuclease R [Acidithiobacillus ferrooxidans ATCC 53993]
Sequence
MPETQEPSSLSDRDPMFDREKEKYERPIVSREYILSYLESAGQPSTLEDIIADLEVSEED
QEALRRRLRAMERDGQLVRNRRGAYGIVEAMELVRGTVSAHPDGFGFLIPEGGGKDLFLS
PREMRKVFHGDTILGRAVGEDRRGRIEGAIVRILERALKQVVGRYYAEGGVRYVVPEDRR
IPQEFAVVEGGELAPVHGQIVTLEITQYPDGRNMPQGCVVEILGEHMAPGMEVEIAVRNY
GLPHQWPDEVLAEITHFSETVPEAIKEGRRDLRALPLVTIDGADAKDFDDAVYAEEIENG
FRLIVAIADVATYVRPDSALDKEAATRGNSVYFPRRVIPMLPEILSNGLCSLNPHVDRLC
MLCEMETDLTGEVQRFRFARGVMRSQRRFTYDEVAAILAGDEDLRTRDAAMVPHLEVLHR
LYESFAKARERRGTIEFDSQESRIIYNEQARIEKIVAVTRNVAHRIIEECMLAANVCAAQ
YFRIHELPMLYRVHPEPSGDKLEDLRRFLGELGVPVRLPTHPRSADLASIIEDTRERSDS
SLIQTVILRSLSQAYYTVDTGMHFGLAFLAYTHFTSPIRRYPDLVVHRGIQALLDAAGAE
PRWFPQKVLQELGQHCSMTERRADEASREAVNWLKCEFMMDKVGETYTGIITGVTGFGLF
VALREIYVEGLIHISTLGEDYFHFDAQHYRIIGDRTKETFQLGDEIQIRVANVNLDDRKI
DFERVMPEGQSGAAKNRRNRRSRKDA
Download sequence
Identical sequences B5EJB3 B7JBZ2
gi|198283673|ref|YP_002219994.1| WP_012536823.1.13253 WP_012536823.1.28209 WP_012536823.1.49158 WP_012536823.1.50737 WP_012536823.1.90948 243159.AFE_1891 380394.Lferr_1565 gi|218667199|ref|YP_002426304.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]