SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|198283981|ref|YP_002220302.1| from Acidithiobacillus ferrooxidans ATCC 53993

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|198283981|ref|YP_002220302.1|
Domain Number 1 Region: 40-123
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.25e-18
Family Cold shock DNA-binding domain-like 0.0000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|198283981|ref|YP_002220302.1|
Sequence length 782
Comment Rne/Rng family ribonuclease [Acidithiobacillus ferrooxidans ATCC 53993]
Sequence
MKRMLINATHAEELRVALVDGQKLLDLDIERAYREQKKSNIYKGRITRVEPSLEAAFVDY
GAERHGFLPLKEIAREYFQQQEQGRKRIQDLVREGQEIIVQVDKEERSSKGAALTTFVSL
AGRYLVLMPNNPRAGGVSRRIEGEDRTQIRQHLQLLDIPENMGVIARTAGIGQELEALQR
DLEYLKQIWQAIVDTAAPRAAPFLIYQEGNVVVRALRDHFSEDIGEVLIDEEGAYNAAVQ
FMGSMMPKMVHRLKYYDNDVPLFSRYQIEQQIESAFSREVRLESGGAIVIDHTEALVAVD
VNSGRATKGQDIAETAFQTNLEAAEEIARQIRLRDLGGLIVVDFIDMESPKHQREVENKL
KEALKLDRARVQLGRISRFGLMEMSRQRLGASLEEASSEPCPRCNGTGQIRGCEATSMHV
LRLLYEECMKTGAAEVECQVPVDVAVYLLNEKRRQILELEAKTDTRILVIPTPEMVTPHY
QIQRTRVEGGSGRTAPAPGGEGNALPARPSRPTNESAALSPLTAPPPPEVLPPLRTPPAP
SSPKAKVPAKVVPPEEGILARLVRALVSRYVPVDAATFLAETSGAEMSASTEQASEISSD
EQENSGEGRSGRRRRRGGRRARARRSTQGGENGAESSSADEEAPEGSYTTEEFQDNDLLA
GPEDDSHALEELVYPGSVPAAADWHQMLVPATTRTPAADPTFQNDPAREVESLPAEEPAS
LTVQEPVKDTTRESLRMAVRQEPTPEPVQGDLLAVETMEHGGAVSVAVPGEAEQQSFPLG
DG
Download sequence
Identical sequences B5EL09 B7J5K7
gi|198283981|ref|YP_002220302.1| WP_012537059.1.13253 WP_012537059.1.28209 WP_012537059.1.49158 WP_012537059.1.50737 WP_012537059.1.90948 243159.AFE_2220 380394.Lferr_1874 gi|218665963|ref|YP_002426618.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]