SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|198284531|ref|YP_002220852.1| from Acidithiobacillus ferrooxidans ATCC 53993

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|198284531|ref|YP_002220852.1|
Domain Number 1 Region: 72-440
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.59e-75
Family (Uracil-5-)-methyltransferase 0.00000393
Further Details:      
 
Domain Number 2 Region: 7-63
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000166
Family TRAM domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|198284531|ref|YP_002220852.1|
Sequence length 440
Comment TrmA family RNA methyltransferase [Acidithiobacillus ferrooxidans ATCC 53993]
Sequence
MSRPKPIHNAQPEQVFIESLDTEGRGIARVEGKVLFVDGALPGERVWARRTQNHKSFDRA
ELLQVDKASSLRVSPPCPHFGVCGGCSLQHLEPAAQVAIKQRQLEDHLWRIGKVRPERVL
PPIHGPSLGYRSKARLSVRTPKTRGAMVGFRERNSSYVVDMGQCLTLDPRVGQRILSLRT
LIGQMQSPQDFPQIEVAATPDAVALVFRHMRPLAESDLQHLRAFGEQHDLQIWLQPRGPE
TLYPLWPEQPEPLHYDLPDYRLRLRFDPLVFTQVNQAANQVMVRRAMALLQPQPGEHILD
LFCGLGNFTLPIARLGAQVLGIEGDARLVALAAENAAANGLADKARYAVADLTQARMEDF
APAGAIDKMLIDPPRSGAIEVLRSLTPGVRRLVYVSCNPATLARDAEYLVHERGYRLRAA
GVVNMFPHTAHVESIALFER
Download sequence
Identical sequences B5EPA4 B7J921 F8XQE8
gi|218667266|ref|YP_002427198.1| 243159.AFE_2828 380394.Lferr_2450 gi|198284531|ref|YP_002220852.1| WP_009564760.1.13253 WP_009564760.1.28209 WP_009564760.1.49158 WP_009564760.1.50737 WP_009564760.1.90948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]