SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|198284547|ref|YP_002220868.1| from Acidithiobacillus ferrooxidans ATCC 53993

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|198284547|ref|YP_002220868.1|
Domain Number 1 Region: 3-156
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.64e-56
Family Single strand DNA-binding domain, SSB 0.00000859
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|198284547|ref|YP_002220868.1|
Sequence length 156
Comment ssDNA-binding protein [Acidithiobacillus ferrooxidans ATCC 53993]
Sequence
MAGVNKVILLGHLGRDPEMRYQPSGGAIANFSIATSETFKDKEGNKQERTEWHRVVLFGR
TAEIAGEYLRKGSMAYVEGRLQTRKWTDKEGQERYTTEIVGDRLQLVGARGGGGGGAASF
DEEDPSRPSGGSSAGGARKNEMPPAPAEDFDDDIPF
Download sequence
Identical sequences B5EPC0 B7J938 E6QFY8
243159.AFE_2845 380394.Lferr_2466 gi|198284547|ref|YP_002220868.1| WP_012537427.1.13253 WP_012537427.1.28209 WP_012537427.1.49158 WP_012537427.1.50737 WP_012537427.1.90948 gi|218666108|ref|YP_002427215.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]