SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|198284647|ref|YP_002220968.1| from Acidithiobacillus ferrooxidans ATCC 53993

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|198284647|ref|YP_002220968.1|
Domain Number 1 Region: 39-133
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.59e-19
Family Cold shock DNA-binding domain-like 0.0012
Further Details:      
 
Weak hits

Sequence:  gi|198284647|ref|YP_002220968.1|
Domain Number - Region: 225-288
Classification Level Classification E-value
Superfamily GAT-like domain 0.018
Family GAT domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|198284647|ref|YP_002220968.1|
Sequence length 496
Comment Rne/Rng family ribonuclease [Acidithiobacillus ferrooxidans ATCC 53993]
Sequence
MSEELLINVTPQEIRVALVDNGVLQELQVERSGHRGLVGNIYKGVVRRVLPGMQAAFVDV
GLERTAFLHAADIQDDSEEIQGETDIEPRAGHHEVRNVCALLREGQEVLVQVIKDPVGSK
GARLSTRITLPGRYLVYMPFVPRIGVSTRIESPEERMRLKEQLKSVIPPEEGGGYIIRTL
AEGVTETDFSGDIDFLRRLWDSIRARLERSPAPGQIHSDLNLALRMMRDVMSDNIQRVRI
DSRETVDAALTFCQGVIPEVADRIEHYSGERPLFDLYNVEDEIERALQSRVTLKSGAYLI
IDQTEALTTVDVNTGGFVGRRNQEETIFKTNLEAAAAIARQMRLRNIGGMIIIDFIDMED
EEHKRRVQRALEKSIQSDRTRCNITQISSLGLVEMTRKRTRESLRQTLCEPCPYCHGRGF
MKTAETICYEILREIVRETRAYPAERFVVLASPQVMEKLLDEESTSLAALEEFIGRPIKV
QAEATYTQEQYDIILM
Download sequence
Identical sequences B5EPW6 B7J9S7 F8XNM0
gi|218667189|ref|YP_002427321.1| 243159.AFE_2954 380394.Lferr_2567 WP_009562675.1.13253 WP_009562675.1.28209 WP_009562675.1.49158 WP_009562675.1.50737 WP_009562675.1.90948 gi|198284647|ref|YP_002220968.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]