SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|198284904|ref|YP_002221225.1| from Acidithiobacillus ferrooxidans ATCC 53993

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|198284904|ref|YP_002221225.1|
Domain Number 1 Region: 90-396
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 3.4e-28
Family Nitrous oxide reductase, N-terminal domain 0.037
Further Details:      
 
Domain Number 2 Region: 509-795
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 0.00000314
Family Arylsulfatase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|198284904|ref|YP_002221225.1|
Sequence length 931
Comment SMP-30/gluconolaconase/LRE domain-containing protein [Acidithiobacillus ferrooxidans ATCC 53993]
Sequence
MKKWNSIVAFAVGSTVMFSVPTFAYVGLSNTRDINAPIHVHTANQDRVTHVLPTGRIVSP
VGLVNGAPNFVTAVVPVGHYVAAMANGATRAQTITLYKQKTLEQVAEIAAYKKGAPKEAP
LPTDATNLRDNVIGHQSFFQGMAVGPDHTIYVAGGGGSDVAAFTVQDGNLKLLRRYPLAW
QPFPKAQYPYTYQGHHIGKPRLFYPDSIAVGHRGRHLYVTGMLSNSLARINLQTGKTDYL
NVGPYPFAVTFADGGKKLVVSLWGGNAVAVVDPETMRLLGTVRVGPPTGPNNTQAGVHPT
ALAAVPHSPYVFVALANIDRVAEIDSADLRVKGFINDSPYPDAPPGSYPDGLTITEGNLF
VANAGNNDVAVYNDQTGKNLGLIPTGWYPTAITHAHHALYIVAAKGLGSGPNVEHQWVGN
MMDGLVQRVRLQHLMFHLPAWTQESLQNDGFTPAQQETRHTEDVKTDAFLRKHIHYVVFI
LRENKTFDEDFGDDQTAGAWADPHLDLYGSQELPNLYHLAHHNTLFVNFMADGEVTAQGH
QWTTSASDSDFVQRTWPEYYSGRGLVANPGWTQSLVPGGATGTGGVPLGVDNPYAIYENL
SALGKWSNPWISFPARLFLFNDLLSHQVSFEDFGEFVSRSQAGNISKAMDQHLATGFPGW
DRMILDTYREKMAVNWLKAHPGSKFPHFIYIWLPDDHTAGRKSCYYTPDYYVANNDYATA
KFIHYLSTTPEWRHMVVFLTEDDAQSGADHINAHRTFALAMGPWVKKGYLETSLYSQVNI
LKTTEAIFGLPPMSQWDQNAGVFSGIWTNHPDFAPTQVLPMQVPVTFNAGKCDHYTLLRR
EAGATGHYLTANETAWYKEHQTPNGAGLPAPSKADTYTPTTLLKVPGPEQMKQEWIASKG
RKSYARVMAYLKAYSAQKDAPVNAYQAGEKE
Download sequence
Identical sequences B5ERH2 B7JBB0
gi|218665843|ref|YP_002427585.1| gi|198284904|ref|YP_002221225.1| 243159.AFE_3230 380394.Lferr_2833 WP_012537668.1.13253 WP_012537668.1.28209 WP_012537668.1.49158 WP_012537668.1.50737 WP_012537668.1.90948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]