SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379018189|ref|YP_005294424.1| from Rickettsia rickettsii str. Hino

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379018189|ref|YP_005294424.1|
Domain Number 1 Region: 4-58
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0000152
Family Phosphate binding protein-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|379018189|ref|YP_005294424.1|
Sequence length 58
Comment hypothetical protein RPJ_05665 [Rickettsia rickettsii str. Hino]
Sequence
MRRTADKKTLINAWYVNEPYQYLIAASNGHTTVSGMDIELMNAIAAKIGINIEYNQDS
Download sequence
Identical sequences gi|378723050|ref|YP_005287936.1| gi|379018189|ref|YP_005294424.1| gi|378724404|ref|YP_005289288.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]