SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379011378|ref|YP_005269190.1| from Acetobacterium woodii DSM 1030

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379011378|ref|YP_005269190.1|
Domain Number 1 Region: 158-344
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.35e-63
Family Methylesterase CheB, C-terminal domain 0.00000254
Further Details:      
 
Domain Number 2 Region: 7-109
Classification Level Classification E-value
Superfamily CheY-like 4.13e-26
Family CheY-related 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|379011378|ref|YP_005269190.1|
Sequence length 345
Comment chemotaxis-specific methylesterase CheB1 [Acetobacterium woodii DSM 1030]
Sequence
MRDKKDQISVLIVDDSIFFREIVSRKLSMEPFIYVIATANNPFDARDKILKYDPDVVICD
VEMPKMNGIEFIRRLLPQYPLPVIVVSSNAGAAADAKKAGALYFVEKPKGDLAKTIEKFI
VELTKKIRIAAKMTVVIPRPLVVEEINQRLDDEAQFTDRIIAIGASTGGTEAIYEILKNL
PSNCPGIVIVQHIPPMFSKMFAQRLDAQTMFQCKEAATGDYLKNGWVYIAPGDKHMRVKR
IGKKYRIEVFEGERVNGHCPSVDILFESVAKEAGAQAIGVLLTGMGYDGAKGLLNIRRKG
ALTIGQDEATSVVYGMNKVAFNMGAVTIQASLEKIHTYILSAIKE
Download sequence
Identical sequences H6LG13
gi|379011378|ref|YP_005269190.1| WP_014355904.1.36127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]