SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379012000|ref|YP_005269812.1| from Acetobacterium woodii DSM 1030

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|379012000|ref|YP_005269812.1|
Domain Number - Region: 78-146
Classification Level Classification E-value
Superfamily Apolipoprotein 0.00209
Family Apolipoprotein 0.018
Further Details:      
 
Domain Number - Region: 31-75
Classification Level Classification E-value
Superfamily ClpS-like 0.0471
Family Ribosomal protein L7/12, C-terminal domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|379012000|ref|YP_005269812.1|
Sequence length 148
Comment hypothetical protein Awo_c21480 [Acetobacterium woodii DSM 1030]
Sequence
MRVLDLLAELEEVVEKGNTLPFSSKAFVNPEEVIEIIDEIRDSLPEELAEAKKIVAERKK
IIFSAQSEADHIKAEAEKRLRELIDTHEITKTATANANEIMKNTNASAKALKTGTQNYAD
KLLYNFQIQLKELNEQIEQNRRELKNIK
Download sequence
Identical sequences H6LBG8
WP_014356523.1.36127 gi|379012000|ref|YP_005269812.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]