SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379012114|ref|YP_005269926.1| from Acetobacterium woodii DSM 1030

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379012114|ref|YP_005269926.1|
Domain Number 1 Region: 3-239
Classification Level Classification E-value
Superfamily Hsp33 domain 5.89e-67
Family Hsp33 domain 0.00000424
Further Details:      
 
Domain Number 2 Region: 231-288
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 2.22e-19
Family HSP33 redox switch-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|379012114|ref|YP_005269926.1|
Sequence length 292
Comment 33 kDa chaperonin [Acetobacterium woodii DSM 1030]
Sequence
MPDYVIKATAGNGQIRVFAATTKEIAETARELHQTSPVVTQALGRLLTAGSLMGSMMKND
DELMTLKIAGDGPMSGLLVTADAHGNVKGYPYVSDLNDSMEAPMLVSEAIGEGSLNILKD
IGLKEPYVGYSPLISGELAEDLTYYFAQSEQIPTSVSLGVLLNDDGTVRQAGGFIIQLLP
DTTDDVIDSLEEALTKTPSLTKLLDQGNSLETIIANLFIDLNLKVSDQTSTRFVCDCSRQ
RITKALISIGKQDLVEMISDQEDIEINCDFCNKKYLFSPADLQAILNRIEEG
Download sequence
Identical sequences H6LCQ0
WP_014356637.1.36127 gi|379012114|ref|YP_005269926.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]