SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379012403|ref|YP_005270215.1| from Acetobacterium woodii DSM 1030

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379012403|ref|YP_005270215.1|
Domain Number 1 Region: 32-107
Classification Level Classification E-value
Superfamily Apolipoprotein 0.000000314
Family Apolipoprotein 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|379012403|ref|YP_005270215.1|
Sequence length 127
Comment hypothetical protein Awo_c25690 [Acetobacterium woodii DSM 1030]
Sequence
MSSNKLYFVGGLFLGTIIGGTLGVLLAPAAGEETRKKLSDSTEEVIGNAYDQAVEYGENL
KEQFQDMQEQFTERVNEYKNQIESKIQEIQDEVEQDIADLNDELEALENEETELKEEVEA
TEEKEDE
Download sequence
Identical sequences H6LE93
gi|379012403|ref|YP_005270215.1| WP_014356926.1.36127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]