SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379013085|ref|YP_005270897.1| from Acetobacterium woodii DSM 1030

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379013085|ref|YP_005270897.1|
Domain Number 1 Region: 5-287
Classification Level Classification E-value
Superfamily Folate-binding domain 4.26e-78
Family Aminomethyltransferase folate-binding domain 0.00000275
Further Details:      
 
Domain Number 2 Region: 437-874
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.87e-72
Family GABA-aminotransferase-like 0.0000594
Further Details:      
 
Domain Number 3 Region: 304-396
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.0000000000132
Family Aminomethyltransferase beta-barrel domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|379013085|ref|YP_005270897.1|
Sequence length 882
Comment aminomethyltransferase GcvT [Acetobacterium woodii DSM 1030]
Sequence
MKLENLKRTLFYDNHVKAGATLVDFGGWEMPIQYPNGIVDEHINTRIKAGIFDVSHMARF
IVSGPEATAFLQYVLTNNVFALDLLQAQYTMIQNQNGGALDDAYLYRFKETEYLLVVNAA
NAEKDWQHLNTEIAAFDATISNQSSEIAMISLQGPESKNILKKLTGYEFLTEPLKNALGI
LDYKGQELLIARTGYTGEPLGFELFAKAAQGPEIWEKLLELGAMAIGLGARDTLRLEAGL
PLYGHELGLDIDGHEIPIFSCPLAKFAVSFADAKGDYIGREALAKQYIGFKKIMERELAD
LSELPRIVRSLAITGRGVARAGCKVFKDGKEVGYITSATMVPYLKAEGYGLDSKITDEKA
MRAIALALVDGDVELNDAVEVEIRGKMVKAVIAPYHMKSDAPPFARPIIYGVEVEREFDS
AADYKTKAINLLEKSYDNTILRQHQTINLIPSEQSHSPAVRLLSIMDPSFRYAEHKKTKS
FYDYDVFYYQGTAFIDEIEHLLMAEMKKYLNCAEVETRVISGQMANTAVFSALMDYKNRV
NRKKDPARLGYVLNNHIIKGGHLSAQPMGALHDYIAIDPVTEKTAVVNFPVEKDNHFKID
VEETKKVIAQYKPELIIFGKSMVLHKEPVREIKKFVDEQKLNSVIMYDMAHVLGLVGDHF
QNPFEEGAELVTGSTHKTFFGTQRGIIAGNYDPEDYKYGLWETIETRAFPGSVSNHHLGT
MLGLLMATYEMNYFKDEYQKNVINNAKYFAKCLADAGLDVVGDPAISYTETHQVVVRVGY
GIGPDVANRLERNNIIINYQATPEEEGFTASGAIRIGVAEMTRFGFGTKEFEQTAALMAD
VILRNKDVIDDVKQLRSNFTELKYCFNDDDIMAQLDKLKSTL
Download sequence
Identical sequences H6LK88
WP_014357604.1.36127 gi|379013085|ref|YP_005270897.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]