SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379010953|ref|YP_005268765.1| from Acetobacterium woodii DSM 1030

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379010953|ref|YP_005268765.1|
Domain Number 1 Region: 119-271
Classification Level Classification E-value
Superfamily 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 6.02e-52
Family 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 0.00016
Further Details:      
 
Domain Number 2 Region: 2-117
Classification Level Classification E-value
Superfamily Tetrahydrobiopterin biosynthesis enzymes-like 1.51e-30
Family DHN aldolase/epimerase 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|379010953|ref|YP_005268765.1|
Sequence length 272
Comment dihydroneopterin aldolase/ 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase FolBK [Acetobacterium woodii DSM 1030]
Sequence
MDKLYIKDFEVFAYHGVFPEEKTLGQKFLISVTLSLDMQEAALTGDLTKSVHYGELCHAL
EIEFTKESYDLIETAGEKLATYVLEHYPMVDHVKIMIKKPWAPILKSMDTVAIEINRGWH
VAFIGLGTNMGNREQNLSEAIAHIKSTSGIKIITQSSIIETEPWGYTDQDFFLNCVLKVK
TTLPPHPLMTLLLEIEHGLKRERTIHWGPRTIDLDILFYDHLISDDPHVVLPHPRVQERA
FVMASMAEIAPYFVHPLLNKRMNEIFENLQNN
Download sequence
Identical sequences H6LD37
WP_014355479.1.36127 gi|379010953|ref|YP_005268765.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]