SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218667423|ref|YP_002426773.1| from Acidithiobacillus ferrooxidans ATCC 23270

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218667423|ref|YP_002426773.1|
Domain Number 1 Region: 30-196
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.00000000205
Family Transferrin 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218667423|ref|YP_002426773.1|
Sequence length 290
Comment hypothetical protein AFE_2384 [Acidithiobacillus ferrooxidans ATCC 23270]
Sequence
MPSPKISSEATLNFTVDPNYSGKNLPGWFLMNTYLQRHLGQIMHFQPYDGFDACRAAVLD
NQYDLVYANPFDWVQYVQKRDFIPIAKPRDHFDEVYLCTAAVGPVREIADLSPRIRIASA
HPATLVHMVGLFLLDKAEIDRARLEFVFTGSYQGVLKAILQGQADVGFLFDEVYTSASSL
IRDHLRIIDRSDDAFAFHAFCVGPRLSAQRDLLTRILCQMDQETRGQVLLQDVGFSGFVP
VSAEEVACLTMLTEEYISGHEAIDLRTTSSLAIDDSAFVVAREDPDSGTN
Download sequence
Identical sequences B5ELP7 B7J6E8 F8XN23
WP_009562226.1.13253 WP_009562226.1.28209 WP_009562226.1.49158 WP_009562226.1.50737 WP_009562226.1.90948 gi|218667423|ref|YP_002426773.1| gi|198284117|ref|YP_002220438.1| 243159.AFE_2384 380394.Lferr_2014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]