SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|218668038|ref|YP_002427578.1| from Acidithiobacillus ferrooxidans ATCC 23270

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218668038|ref|YP_002427578.1|
Domain Number 1 Region: 1-224,268-349
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 4.84e-47
Family ADP-ribosylglycohydrolase 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218668038|ref|YP_002427578.1|
Sequence length 356
Comment ADP-ribosylglycohydrolase family protein [Acidithiobacillus ferrooxidans ATCC 23270]
Sequence
MQRVAGAVMGALIGDALALGCHWYYDLAELRRECGPWITDYLTPRPDRYHGGLRAGDISQ
TGLLLVMLMESLVHCAGYEEDDFTRRLDTELFPQLDGTPMQGPGGYTNQSIREAWRKRVP
EHRPWGECAGDADTTEGAERAVAIAALYALQPKKMAEAVCSNIILTQHDPAIVAMSVAFN
AVLAQLVSGVSLTPQIGATLMAQVRSGALPFHMVTQGHLQPPPQGGERMQVGQFTSPDAL
LTAGYAALAAADPDIVIEPAWKVSLVYGMPCAIYHQLPAAYYLASRFREDYESAVLHAIN
GGGQNMSRAMLTGALVGAQVGLEGIPRRFITGLRDAQRYLALAAELEQWAVRQETL
Download sequence
Identical sequences B5ERG6 B7JBA3
gi|218668038|ref|YP_002427578.1| gi|198284898|ref|YP_002221219.1| WP_012537666.1.13253 WP_012537666.1.28209 WP_012537666.1.49158 WP_012537666.1.50737 WP_012537666.1.90948 243159.AFE_3222 380394.Lferr_2826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]