SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|529990302|ref|YP_007993688.1| from Klebsiella pneumoniae subsp. rhinoscleromatis SB3432

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|529990302|ref|YP_007993688.1|
Domain Number 1 Region: 3-363
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 2.62e-108
Family FMN-linked oxidoreductases 0.0000000000634
Further Details:      
 
Domain Number 2 Region: 334-520
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2.65e-41
Family N-terminal domain of adrenodoxin reductase-like 0.00000152
Further Details:      
 
Domain Number 3 Region: 462-519,557-651
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.16e-23
Family C-terminal domain of adrenodoxin reductase-like 0.00000204
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|529990302|ref|YP_007993688.1|
Sequence length 673
Comment fadH [Klebsiella pneumoniae]
Sequence
MSRYPSLFAPLELGFTTLKNRVLMGSMHTGLEELPDGAQRLAAFYAERARHGVALIVTGG
IAPAPSGVTMAGGAVLNDASHLAHHRHITDAVHQEGGKIALQILHTGRYSYQPALVAPSA
LQAPINRFTPHELSHDEILTLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLAARTNQ
RDDQWGGDYARRMRFAVEVVKAVRQRAGHDFIIIYRLSMLDLVNDGSTLAEVTELAKAIE
AAGATIINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGAVSIPLITTNRINDPQVAEDI
LARGDADMVSMARPFLADAEFISKAQDDRADQINTCIGCNQACLDRIFVGKVTSCLVNPR
ACHETLMPVLPANAPKRLAVVGAGPAGLAFAVNAAARGHHVTLFDALPEIGGQFNIAKQI
PGKEEFHETLRYYRTMLDLHGVDLRLNTRVTTDDLLAFDETILATGIAPRLPAIDGIDHP
KVLSYLDVLRDKAPVGAKMAIIGCGGIGFDTAMFLSQSGAATSQDIGEFCREWGIDTSLQ
TAGGLSAEGPQLSKSPRQIVMLQRKASKPGEGLGKTTGWIHRATLLARGVKMIPAVSYEK
IDDEGLHVTIGGERQLLAVDQVVICAGQEPRRELADPLRAAGKTVHLIGGCDVAAELDAR
RAIAQGTKLALAI
Download sequence
Identical sequences C8T5E8 R4YEL7
WP_004144840.1.30072 WP_004144840.1.517 gi|529990302|ref|YP_007993688.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]