SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|529985883|ref|YP_007989269.1| from Klebsiella pneumoniae subsp. rhinoscleromatis SB3432

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|529985883|ref|YP_007989269.1|
Domain Number 1 Region: 3-322
Classification Level Classification E-value
Superfamily FMN-binding split barrel 4.32e-128
Family UbiD middle domain-like 0.00000000000873
Further Details:      
 
Domain Number 2 Region: 323-486
Classification Level Classification E-value
Superfamily UbiD C-terminal domain-like 4.05e-66
Family UbiD C-terminal domain-like 0.0000000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|529985883|ref|YP_007989269.1|
Sequence length 491
Comment ubiD [Klebsiella pneumoniae]
Sequence
MKYHDLRDFLTLLEQQGELKRITLPVDPHLEITEIADRTLRAGGPALLFENPKGYTMPVL
CNLFGTPRRVALGMGQEDVSSLREVGKLLAFLKEPEPPKGFRDLFDKLPQFKQVLNMPTK
RLRGAPCQQKIIQGDDVDLNKIPIMTCWPEDAAPLITWGLTVTRGPHKERQNLGIYRQQL
IGKNKLIMRWLSHRGGALDFQEWCAARPGERFPVSVALGADPATILGAVTPVPDTLSEYA
FAGLLRGTKTEVVKCVSNDLEVPASAEIVLEGYIEAGEMAPEGPYGDHTGYYNEVDSFPV
FTVTHITQREDAIYHSTYTGRPPDEPAVLGVALNEVFVPILQKQFPEIVDFYLPPEGCSY
RLAVVTMKKQYAGHAKRVMMGVWSFLRQFMYTKFVIVCDDDVNARDWNDVIWAITTRMDP
ARDTVLVENTPIDYLDFASPVSGLGSKMGLDATNKWPGETQREWGRPIKKDPAVTARIDA
IWDELAIFKQQ
Download sequence
Identical sequences A0A0E1GR09 A0A2D3CY91 A6TGM1 C8T0F0 J2X0R5 R4Y4I8 W1BEF1
WP_004146456.1.100175 WP_004146456.1.100239 WP_004146456.1.100268 WP_004146456.1.100385 WP_004146456.1.100465 WP_004146456.1.10061 WP_004146456.1.100698 WP_004146456.1.10102 WP_004146456.1.10134 WP_004146456.1.101702 WP_004146456.1.10203 WP_004146456.1.10296 WP_004146456.1.10395 WP_004146456.1.10681 WP_004146456.1.11036 WP_004146456.1.11122 WP_004146456.1.11147 WP_004146456.1.11267 WP_004146456.1.11535 WP_004146456.1.11683 WP_004146456.1.11742 WP_004146456.1.11808 WP_004146456.1.11864 WP_004146456.1.11891 WP_004146456.1.12086 WP_004146456.1.12445 WP_004146456.1.12564 WP_004146456.1.12722 WP_004146456.1.13386 WP_004146456.1.14109 WP_004146456.1.14171 WP_004146456.1.14248 WP_004146456.1.14580 WP_004146456.1.14594 WP_004146456.1.14735 WP_004146456.1.1478 WP_004146456.1.14796 WP_004146456.1.15060 WP_004146456.1.15243 WP_004146456.1.15331 WP_004146456.1.15878 WP_004146456.1.16289 WP_004146456.1.16299 WP_004146456.1.16314 WP_004146456.1.16380 WP_004146456.1.16542 WP_004146456.1.16659 WP_004146456.1.16877 WP_004146456.1.16917 WP_004146456.1.17661 WP_004146456.1.18171 WP_004146456.1.18176 WP_004146456.1.18378 WP_004146456.1.18431 WP_004146456.1.1869 WP_004146456.1.18736 WP_004146456.1.18832 WP_004146456.1.1937 WP_004146456.1.19989 WP_004146456.1.20122 WP_004146456.1.20179 WP_004146456.1.20205 WP_004146456.1.2023 WP_004146456.1.20476 WP_004146456.1.21088 WP_004146456.1.21228 WP_004146456.1.21799 WP_004146456.1.21953 WP_004146456.1.22215 WP_004146456.1.22534 WP_004146456.1.22630 WP_004146456.1.2265 WP_004146456.1.22712 WP_004146456.1.22929 WP_004146456.1.2346 WP_004146456.1.23562 WP_004146456.1.23672 WP_004146456.1.23758 WP_004146456.1.23877 WP_004146456.1.23982 WP_004146456.1.24055 WP_004146456.1.24103 WP_004146456.1.24342 WP_004146456.1.24816 WP_004146456.1.24822 WP_004146456.1.25163 WP_004146456.1.25239 WP_004146456.1.25306 WP_004146456.1.2536 WP_004146456.1.25379 WP_004146456.1.25407 WP_004146456.1.25563 WP_004146456.1.25575 WP_004146456.1.25904 WP_004146456.1.25918 WP_004146456.1.25920 WP_004146456.1.26067 WP_004146456.1.26299 WP_004146456.1.26308 WP_004146456.1.26336 WP_004146456.1.26427 WP_004146456.1.26762 WP_004146456.1.26843 WP_004146456.1.2686 WP_004146456.1.26890 WP_004146456.1.27144 WP_004146456.1.27319 WP_004146456.1.27488 WP_004146456.1.27543 WP_004146456.1.27722 WP_004146456.1.27828 WP_004146456.1.28049 WP_004146456.1.2814 WP_004146456.1.28203 WP_004146456.1.28463 WP_004146456.1.28688 WP_004146456.1.28717 WP_004146456.1.28764 WP_004146456.1.28857 WP_004146456.1.28972 WP_004146456.1.29120 WP_004146456.1.29240 WP_004146456.1.29334 WP_004146456.1.29466 WP_004146456.1.29506 WP_004146456.1.29829 WP_004146456.1.29871 WP_004146456.1.2990 WP_004146456.1.2999 WP_004146456.1.30072 WP_004146456.1.30078 WP_004146456.1.30300 WP_004146456.1.30339 WP_004146456.1.30390 WP_004146456.1.30416 WP_004146456.1.3111 WP_004146456.1.31257 WP_004146456.1.31459 WP_004146456.1.3159 WP_004146456.1.31920 WP_004146456.1.32023 WP_004146456.1.32300 WP_004146456.1.32797 WP_004146456.1.32936 WP_004146456.1.33406 WP_004146456.1.33414 WP_004146456.1.33498 WP_004146456.1.33836 WP_004146456.1.33942 WP_004146456.1.33985 WP_004146456.1.34110 WP_004146456.1.34200 WP_004146456.1.34258 WP_004146456.1.34281 WP_004146456.1.34367 WP_004146456.1.34481 WP_004146456.1.3450 WP_004146456.1.34507 WP_004146456.1.34771 WP_004146456.1.34910 WP_004146456.1.35028 WP_004146456.1.35268 WP_004146456.1.35284 WP_004146456.1.35286 WP_004146456.1.3529 WP_004146456.1.35453 WP_004146456.1.35914 WP_004146456.1.36025 WP_004146456.1.36029 WP_004146456.1.36080 WP_004146456.1.36151 WP_004146456.1.36204 WP_004146456.1.36388 WP_004146456.1.36468 WP_004146456.1.36659 WP_004146456.1.36825 WP_004146456.1.37456 WP_004146456.1.37565 WP_004146456.1.37614 WP_004146456.1.37617 WP_004146456.1.38096 WP_004146456.1.38215 WP_004146456.1.38399 WP_004146456.1.38448 WP_004146456.1.38684 WP_004146456.1.38729 WP_004146456.1.38799 WP_004146456.1.38838 WP_004146456.1.38849 WP_004146456.1.39149 WP_004146456.1.39391 WP_004146456.1.39456 WP_004146456.1.39482 WP_004146456.1.39637 WP_004146456.1.39677 WP_004146456.1.3988 WP_004146456.1.40054 WP_004146456.1.40597 WP_004146456.1.40798 WP_004146456.1.40817 WP_004146456.1.40825 WP_004146456.1.41096 WP_004146456.1.41159 WP_004146456.1.41405 WP_004146456.1.41872 WP_004146456.1.42139 WP_004146456.1.42264 WP_004146456.1.42464 WP_004146456.1.42584 WP_004146456.1.42724 WP_004146456.1.4286 WP_004146456.1.42881 WP_004146456.1.43050 WP_004146456.1.43221 WP_004146456.1.43228 WP_004146456.1.43445 WP_004146456.1.43833 WP_004146456.1.43867 WP_004146456.1.4393 WP_004146456.1.43941 WP_004146456.1.44158 WP_004146456.1.44235 WP_004146456.1.44708 WP_004146456.1.45137 WP_004146456.1.45445 WP_004146456.1.45557 WP_004146456.1.45594 WP_004146456.1.45607 WP_004146456.1.45821 WP_004146456.1.46134 WP_004146456.1.46221 WP_004146456.1.46254 WP_004146456.1.46384 WP_004146456.1.46561 WP_004146456.1.46776 WP_004146456.1.4697 WP_004146456.1.47104 WP_004146456.1.47199 WP_004146456.1.47264 WP_004146456.1.47815 WP_004146456.1.48274 WP_004146456.1.48587 WP_004146456.1.48606 WP_004146456.1.48893 WP_004146456.1.48904 WP_004146456.1.49035 WP_004146456.1.49052 WP_004146456.1.49209 WP_004146456.1.49267 WP_004146456.1.49424 WP_004146456.1.49579 WP_004146456.1.49589 WP_004146456.1.49877 WP_004146456.1.50018 WP_004146456.1.50029 WP_004146456.1.50195 WP_004146456.1.5054 WP_004146456.1.50541 WP_004146456.1.50866 WP_004146456.1.50992 WP_004146456.1.51400 WP_004146456.1.5143 WP_004146456.1.51438 WP_004146456.1.51561 WP_004146456.1.51563 WP_004146456.1.51614 WP_004146456.1.51698 WP_004146456.1.517 WP_004146456.1.51922 WP_004146456.1.52054 WP_004146456.1.522 WP_004146456.1.52287 WP_004146456.1.52425 WP_004146456.1.52678 WP_004146456.1.52775 WP_004146456.1.53391 WP_004146456.1.53472 WP_004146456.1.53716 WP_004146456.1.53734 WP_004146456.1.53967 WP_004146456.1.54676 WP_004146456.1.54739 WP_004146456.1.54952 WP_004146456.1.55171 WP_004146456.1.5535 WP_004146456.1.55577 WP_004146456.1.55632 WP_004146456.1.55648 WP_004146456.1.56104 WP_004146456.1.56118 WP_004146456.1.56750 WP_004146456.1.5682 WP_004146456.1.57501 WP_004146456.1.57624 WP_004146456.1.57716 WP_004146456.1.57886 WP_004146456.1.58028 WP_004146456.1.58099 WP_004146456.1.58134 WP_004146456.1.58479 WP_004146456.1.58579 WP_004146456.1.58594 WP_004146456.1.58865 WP_004146456.1.58994 WP_004146456.1.5903 WP_004146456.1.59557 WP_004146456.1.59559 WP_004146456.1.59616 WP_004146456.1.59661 WP_004146456.1.59796 WP_004146456.1.59865 WP_004146456.1.59936 WP_004146456.1.59972 WP_004146456.1.59993 WP_004146456.1.60074 WP_004146456.1.60276 WP_004146456.1.6042 WP_004146456.1.60483 WP_004146456.1.60681 WP_004146456.1.60774 WP_004146456.1.60964 WP_004146456.1.61178 WP_004146456.1.61272 WP_004146456.1.61672 WP_004146456.1.61775 WP_004146456.1.61898 WP_004146456.1.61973 WP_004146456.1.62090 WP_004146456.1.62126 WP_004146456.1.62234 WP_004146456.1.62306 WP_004146456.1.62520 WP_004146456.1.62664 WP_004146456.1.62719 WP_004146456.1.6302 WP_004146456.1.63098 WP_004146456.1.63395 WP_004146456.1.6346 WP_004146456.1.63671 WP_004146456.1.63785 WP_004146456.1.63802 WP_004146456.1.63956 WP_004146456.1.64191 WP_004146456.1.64240 WP_004146456.1.64453 WP_004146456.1.64768 WP_004146456.1.64826 WP_004146456.1.65254 WP_004146456.1.65436 WP_004146456.1.65723 WP_004146456.1.65766 WP_004146456.1.6591 WP_004146456.1.66020 WP_004146456.1.66236 WP_004146456.1.66415 WP_004146456.1.6644 WP_004146456.1.66481 WP_004146456.1.66577 WP_004146456.1.66709 WP_004146456.1.67399 WP_004146456.1.67591 WP_004146456.1.67805 WP_004146456.1.68511 WP_004146456.1.6885 WP_004146456.1.68986 WP_004146456.1.69268 WP_004146456.1.69613 WP_004146456.1.69635 WP_004146456.1.69947 WP_004146456.1.7000 WP_004146456.1.70140 WP_004146456.1.70543 WP_004146456.1.70550 WP_004146456.1.70681 WP_004146456.1.7072 WP_004146456.1.70765 WP_004146456.1.7087 WP_004146456.1.71092 WP_004146456.1.71504 WP_004146456.1.71611 WP_004146456.1.71704 WP_004146456.1.71720 WP_004146456.1.71751 WP_004146456.1.72406 WP_004146456.1.72482 WP_004146456.1.72575 WP_004146456.1.72765 WP_004146456.1.72899 WP_004146456.1.7320 WP_004146456.1.73510 WP_004146456.1.73558 WP_004146456.1.73691 WP_004146456.1.73770 WP_004146456.1.73780 WP_004146456.1.740 WP_004146456.1.74110 WP_004146456.1.74253 WP_004146456.1.74732 WP_004146456.1.74759 WP_004146456.1.75307 WP_004146456.1.75398 WP_004146456.1.75457 WP_004146456.1.75888 WP_004146456.1.75962 WP_004146456.1.76199 WP_004146456.1.76370 WP_004146456.1.76416 WP_004146456.1.76496 WP_004146456.1.76512 WP_004146456.1.76561 WP_004146456.1.76935 WP_004146456.1.76943 WP_004146456.1.76991 WP_004146456.1.77034 WP_004146456.1.77340 WP_004146456.1.77467 WP_004146456.1.77547 WP_004146456.1.77645 WP_004146456.1.77831 WP_004146456.1.78171 WP_004146456.1.78268 WP_004146456.1.78300 WP_004146456.1.78387 WP_004146456.1.78540 WP_004146456.1.79021 WP_004146456.1.79091 WP_004146456.1.79582 WP_004146456.1.79756 WP_004146456.1.79857 WP_004146456.1.80027 WP_004146456.1.80350 WP_004146456.1.80412 WP_004146456.1.80554 WP_004146456.1.80772 WP_004146456.1.80829 WP_004146456.1.81255 WP_004146456.1.81350 WP_004146456.1.81569 WP_004146456.1.81633 WP_004146456.1.81675 WP_004146456.1.81851 WP_004146456.1.81908 WP_004146456.1.82129 WP_004146456.1.82170 WP_004146456.1.82238 WP_004146456.1.82399 WP_004146456.1.82659 WP_004146456.1.82769 WP_004146456.1.83608 WP_004146456.1.84377 WP_004146456.1.84549 WP_004146456.1.84553 WP_004146456.1.84569 WP_004146456.1.84737 WP_004146456.1.84801 WP_004146456.1.85390 WP_004146456.1.8549 WP_004146456.1.85497 WP_004146456.1.85539 WP_004146456.1.85571 WP_004146456.1.85622 WP_004146456.1.85702 WP_004146456.1.858 WP_004146456.1.85877 WP_004146456.1.85957 WP_004146456.1.85965 WP_004146456.1.86031 WP_004146456.1.86039 WP_004146456.1.86194 WP_004146456.1.86339 WP_004146456.1.86533 WP_004146456.1.8668 WP_004146456.1.86932 WP_004146456.1.87027 WP_004146456.1.87063 WP_004146456.1.87150 WP_004146456.1.87214 WP_004146456.1.87313 WP_004146456.1.87315 WP_004146456.1.87343 WP_004146456.1.87441 WP_004146456.1.87628 WP_004146456.1.87693 WP_004146456.1.87929 WP_004146456.1.87931 WP_004146456.1.88274 WP_004146456.1.88406 WP_004146456.1.88500 WP_004146456.1.8853 WP_004146456.1.88551 WP_004146456.1.88615 WP_004146456.1.88875 WP_004146456.1.8896 WP_004146456.1.89096 WP_004146456.1.89115 WP_004146456.1.89117 WP_004146456.1.89142 WP_004146456.1.89327 WP_004146456.1.89430 WP_004146456.1.89593 WP_004146456.1.8966 WP_004146456.1.89919 WP_004146456.1.89961 WP_004146456.1.8999 WP_004146456.1.89991 WP_004146456.1.9012 WP_004146456.1.90142 WP_004146456.1.90382 WP_004146456.1.90446 WP_004146456.1.90636 WP_004146456.1.91001 WP_004146456.1.91301 WP_004146456.1.91444 WP_004146456.1.91461 WP_004146456.1.91522 WP_004146456.1.91534 WP_004146456.1.91604 WP_004146456.1.91676 WP_004146456.1.91729 WP_004146456.1.92035 WP_004146456.1.92046 WP_004146456.1.9216 WP_004146456.1.92174 WP_004146456.1.92280 WP_004146456.1.92901 WP_004146456.1.93226 WP_004146456.1.93342 WP_004146456.1.93685 WP_004146456.1.93757 WP_004146456.1.93764 WP_004146456.1.94200 WP_004146456.1.94696 WP_004146456.1.94721 WP_004146456.1.94777 WP_004146456.1.94837 WP_004146456.1.94871 WP_004146456.1.9511 WP_004146456.1.95189 WP_004146456.1.95238 WP_004146456.1.95349 WP_004146456.1.95527 WP_004146456.1.96010 WP_004146456.1.96225 WP_004146456.1.96774 WP_004146456.1.96802 WP_004146456.1.96842 WP_004146456.1.96881 WP_004146456.1.97025 WP_004146456.1.9745 WP_004146456.1.97463 WP_004146456.1.97500 WP_004146456.1.97636 WP_004146456.1.97734 WP_004146456.1.97759 WP_004146456.1.98125 WP_004146456.1.98499 WP_004146456.1.98816 WP_004146456.1.98871 WP_004146456.1.99016 WP_004146456.1.99245 WP_004146456.1.99264 WP_004146456.1.99705 gi|386037460|ref|YP_005957373.1| gi|529985883|ref|YP_007989269.1| 272620.KPN_04337 gi|152972826|ref|YP_001337972.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]