SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|KLLA0B12518g from Kluyveromyces lactis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|KLLA0B12518g
Domain Number 1 Region: 6-232
Classification Level Classification E-value
Superfamily RNA-binding protein She2p 7.06e-97
Family RNA-binding protein She2p 0.00000831
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|KLLA0B12518g
Sequence length 241
Comment similar to uniprot|P36068 Saccharomyces cerevisiae YKL130C SHE2 RNA-binding protein that binds specific mRNAs and interacts with She3p part of the mRNA localization machinery that restricts accumulation of certain proteins to the bud [Kluyveromyces lactis] Complete CDS. KLLA0B12518g
Sequence
MAYCQVVISKEILDAVLQLVSTYSNYISRYVDYLNNLIAVQRRVSTLRFERMTLIKYVKK
LRFMADVLHSWSFEGENDLIGKRLNEVIDPLGAYLIKVFEILDLLNFYITQPMRGETISK
TLNEDLVVSEETIVCINDSYRIYIKGIQWLVESISERNGNCPHLALELIEFTRKCAIEDE
VDFTASEDILLQDVAIVEVEEEYVDLLHDWSAILVQKQTEMKELFSEDSKRWASMTKPVK
K
Download sequence
Identical sequences Q6CVF1
28985.Q6CVF1 XP_452088.1.35115 gnl|GLV|KLLA0B12518g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]