SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|KLLA0E00683g from Kluyveromyces lactis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|KLLA0E00683g
Domain Number 1 Region: 126-251
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 2.27e-37
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.0000161
Further Details:      
 
Domain Number 2 Region: 20-124
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 6.74e-30
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|KLLA0E00683g
Sequence length 254
Comment highly similar to uniprot|P21801 Saccharomyces cerevisiae YLL041C SDH2 Iron-sulfur protein subunit of succinate dehydrogenase (Sdh1p Sdh2p Sdh3p Sdh4p) which couples the oxidation of succinate to the transfer of electrons to ubiquinone [Kluyveromyces lactis] Complete CDS. KLLA0E00683g
Sequence
MFNAIIKRGLATEAKAVAPRLKTFKIYRWSPDRPAEKPRLQEYQVDLNQCGPMVLDALIK
IKNEQDATLTFRRSCREGICGSCAMNIGGRNTLACLCRIDQNENKQTKIYPLPHMYIVRD
LVPDLTHFYKQYKSIQPYLQRSEVPADGKENLQSIADRKKLDGLYECILCACCSTSCPSY
WWNQEQYLGPAVLMQAYRWLVDSRDEAAGIRKQMLQNSMSLYRCHTIMNCTRTCPKGLNP
GRAIAEIKKALAVD
Download sequence
Identical sequences Q6CQ12
XP_453977.1.35115 28985.Q6CQ12 gnl|GLV|KLLA0E00683g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]