SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|KLLA0E08845g from Kluyveromyces lactis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|KLLA0E08845g
Domain Number 1 Region: 69-181
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 8.55e-37
Family Frataxin-like 0.00000861
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|KLLA0E08845g
Sequence length 190
Comment similar to uniprot|Q07540 Saccharomyces cerevisiae YDL120W YFH1 Yeast Frataxin Homologue mitochondrial protein that regulates mitochondrial iron accumulation [Kluyveromyces lactis] Complete CDS. KLLA0E08845g
Sequence
MLVKNSSRVIRSVISRRSIVTKAIPSIGLARTAPTRAPVLSKLGILNQHNLPFVTVQRMH
NSIAASTDGKTIPEEILDMPIEVYHEISDEFMDSLLDQLEILCDYHPEVVQDVEMSQGVM
SIEVPSVGTYVINKQPPNKQIWLASPVSGPNRFDYYQKEWVSLRDGTKLLDILNKELSDR
LEGDEIDLHY
Download sequence
Identical sequences Q6CNZ1
XP_454348.1.35115 gnl|GLV|KLLA0E08845g 28985.Q6CNZ1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]