SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|KLLA0C12837g from Kluyveromyces lactis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|KLLA0C12837g
Domain Number 1 Region: 277-356
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000192
Family U-box 0.074
Further Details:      
 
Domain Number 2 Region: 160-194
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000122
Family Retrovirus zinc finger-like domains 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|KLLA0C12837g
Sequence length 424
Comment similar to uniprot|P35728 Saccharomyces cerevisiae YKL059C MPE1 Essential conserved subunit of CPF (cleavage and polyadenylation factor) plays a role in 3' end formation of mRNA via the specific cleavage and polyadenylation of pre-mRNA contains a putative RNA- binding zinc knuckle motif [Kluyveromyces lactis] Complete CDS. KLLA0C12837g
Sequence
MSSTIYYKFRSQKDTFRVGFDGTGITVFDLKREIINDNKLGDGTDFQLKIYNPDTLEEYE
DDTTVIGRSSMVIAKRCPSVKLSVNGKSVIGNATRYVMGKPRVMSKRAMTPSVTSSGNAK
VEGQTEEERIANMFANQETQWEQTQQEMSQAQPIFQQRNVGSAPGQDQEPPPPGYMCYRC
GGRGHWIKNCPTNNNPNFEGKRIKRTTGIPKKFLKSIEIDPSSMTPEEMAEKKIMVTDEG
KFVVHMADQTSWEDYQRRQQQQSYMMSQEDKLYMKGQFPDLPDELKCCLTGGLLRDPVKC
TKCCGKVVSRLAMEDALLESDFVCPLCQTSDILLDSLEPVQEIQRKVQEFIKQNKKRLLE
EEPVAGAAPVAETGVKKPKVMPPPPVPFMPFMFPMAPFFGVPSSTQQVQPQNQNQQEPSV
QPKN
Download sequence
Identical sequences Q6CTG7
XP_452772.1.35115 gnl|GLV|KLLA0C12837g 28985.Q6CTG7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]