SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|KLLA0D15455g from Kluyveromyces lactis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|KLLA0D15455g
Domain Number 1 Region: 15-402
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 9.21e-111
Family IF2B-like 0.000000000902
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|KLLA0D15455g
Sequence length 407
Comment similar to uniprot|Q06489 Saccharomyces cerevisiae YPR118W Methylthioribose-1-phosphate isomerase catalyzes the isomerization of 5-methylthioribose-1-phosphate to 5- methylthioribulose-1-phosphate in the methionine salvage pathway [Kluyveromyces lactis] Complete CDS. KLLA0D15455g
Sequence
MSLKAIVFDRVLGKCSVKILDQLLLPYQTQYLTINTIDDGYRSIKSMQVRGAPAIAIVGV
LSTLMECQLLLQESFVKTQSFYDLTQLEKILNERLDLLLSSRPTAVNLSNAITDLRKLIS
NDIGKTYNSLFQYACDIIDHDYADNFTMGENGAKHLLAQLEKEAFEGDFGVLTICNTGSL
ATSGYGTALGVIRSLYERTKKQISGDEQPKRTKTSNAKMVRVFPLETRPYNQGSRLTAYE
LLHDEIPSTLITDSSISYLVSTSKIPIKAAFVGADRIVKNGDTANKIGTYQLSIVCRHFG
IKFYVVAPTTTFDSNTETGDKIVVEERPPNEFRFVQGTLIDGTDPTPVLNESKTPVKAKV
GITPLDMPVWNPSFDITPYTHIDGIITEKGVFAKDENGNFHLETAFQ
Download sequence
Identical sequences Q6CQP3
gnl|GLV|KLLA0D15455g XP_453746.1.35115 28985.Q6CQP3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]