SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|KLLA0E09835g from Kluyveromyces lactis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|KLLA0E09835g
Domain Number 1 Region: 169-389
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 6.95e-90
Family ATP sulfurylase catalytic domain 0.00000000293
Further Details:      
 
Domain Number 2 Region: 3-168
Classification Level Classification E-value
Superfamily PUA domain-like 2.58e-53
Family ATP sulfurylase N-terminal domain 0.000000278
Further Details:      
 
Domain Number 3 Region: 391-502
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.54e-27
Family ATP sulfurylase C-terminal domain 0.0000628
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|KLLA0E09835g
Sequence length 502
Comment highly similar to uniprot|P08536 Saccharomyces cerevisiae YJR010W MET3 ATP sulfurylase catalyzes the primary step of intracellular sulfate activation essential for assimilatory reduction of sulfate to sulfide involved in methionine metabolism [Kluyveromyces lactis] Complete CDS. KLLA0E09835g
Sequence
MPSPHGGVLQDLVARDASKKAELLEIAQSGDLTSWSLTARQICDLELILNGGFSPLDGFL
NQQDYQSVVEKSRLQNGLVWTIPITLDVDAEFASQLSPDQRIVLLQDNEFPLAILTVSDV
YQPDKAVEAKKVFRGDPEHPAVKYLFEQAGEFYVGGSLEAIQLPVHYDYPGWRKTPAQLR
LEFESKQWDRVVAFQTRNPMHRAHRELTVRAARSNNSKILIHPVVGLTKPGDIDHHTRVR
VYQEIIKRYPNGMAQLSLLPLAMRMGGDREAVWHAIIRKNYGASHFIVGRDHAGPGKNSK
GVDFYGPYDAQELVESYKNELDIEVVPFRMVTYLPDEDRYAPIDEIDTDKTRTLNISGTE
LRNRLRDGGEIPAWFSYPEVVKILRESNPSRPKQGFALVLSETLPAQLKTALLSTFLQYG
GGRHYKVLEHGNNEEILALVPDFVRSGTGLILQNASSLKGTNVFKIGEESGSDIPLETED
KNILHIVQRVVLFLEDQGFFQF
Download sequence
Identical sequences Q6CNU6
XP_454393.1.35115 28985.Q6CNU6 gnl|GLV|KLLA0E09835g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]