SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|KLLA0F08327g from Kluyveromyces lactis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|KLLA0F08327g
Domain Number 1 Region: 223-509,547-598
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.17e-86
Family IF2B-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|KLLA0F08327g
Sequence length 602
Comment similar to uniprot|P12754 Saccharomyces cerevisiae YGR083C GCD2 Delta subunit of the translation initiation factor eIF2B the guanine-nucleotide exchange factor for eIF2 activity subsequently regulated by phosphorylated eIF2 first identified as a negative regulator of GCN4 expression [Kluyveromyces lactis] Complete CDS. KLLA0F08327g
Sequence
MTGGAKEASGKETNTEKTANAQEGEKPLSNKELKELKKKEKAAKRAASKQASGISIEKQQ
QQAAAKREKKQQQRDLLAAKKNKAADPVKHDTKKSTLFGHLETAEERRASLLAVSSAITS
TGTSRITANGLVLPLLATTPAVAVSQPMSASPLSSNLSGSNTNLAGLAHSEDFEAHQMLN
SLSLDESSSFVPGISSVIPNTMTSQFTNQQSIASVKELIANREMLHPAITSLTLDYAFYK
IIGSIPRCIAMLEAFQLVVRDYKTPEGTTLSRNLTSYLSHQIDFLKKSRPLSVTMGNAIR
WLKQEISLIDPSTPDSKAKKELCDKIAQFARERVQLADQLIIETASQHIEEGSTILTYGC
SKVLTDLFLHNAINFGKNFQIVIVDSRPLFEGRKMAESLRNQGLNVLYVPITALGTVFNM
DIKYVFLGAHSILSNGFLYSRVGTAQIAMLASRRNIPVLVCCESLKFSQRVQLDSVTSNE
LADPNDLVTIDSANPVQRRNNNGFLLQQFIKEREAQQKEVENSSKQNNKSGSANTNNATA
DEGKNVKDKPILAEWEKSPNLHIFNIMYDLTPPDYIKKIITEFGSLPPSSVPVVLREYKA
SA
Download sequence
Identical sequences Q6CKT1
gnl|GLV|KLLA0F08327g XP_455458.1.35115 28985.Q6CKT1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]